Identifiers and Description

Gene Model Identifier

Contig903.1.g86

Standard Name

None

Aliases

Contig903_1_g86

Description

Sec23/Sec24 trunk domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001384307.002255246328404e-132Sec23/Sec24 trunk domain conta
ining protein
SGDYNL049C2.9987037581344066e-55SFB2 SGDID:S000004994, Chr XIV
from 537911-535281, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig903.1.g86(coding)
ATGATGAGCTACTAGAGAAATATCAATAATTAAGGGGCAGCAGGATACAATCAGCCTCCT
CCAACTACAGGTGGATTAAACAAAAACTAGAATGTACAGGGAGCAGCATCGCAATAGCAG
AATTATTATTAATAAGAAGGGGCTAATGGTTATGGAGGAAGTAATCAATAACAAAATCTG
GGAGGAGCAGTAGGTGGAGGATAGCAGTAGAATGACAACTTATACAACTAAGCTTAATCA
GATCAATATTATCAGACTGATTAAAATGAGCAGTAGTATTACGACGGTTCGTAGTAGCAG
CAATATGATTATGGGGAGGAAGACTATAGTGGAGCGTATGCTGGACAGCAGCAGGTGCCA
GATCAATAATATCAAAATTCAGCAGGAGCAGCTGGGTATGCTACCACTGCATAATCAAGA
ACTAATGTGGGAGCTGGTTCAGGAACAGGGGCTGCCTAATTTTATTAAACACAACCATCC
ACATAAACACCATAAACAAACGCAGTCGGCTTTTAATCCTAGTCATAAAATATGGTTTCT
TAGTAAAATACTCAGCATTACAGCTCAGTAGCAGCAACCACTTCACTTGAAGAATTCAAC
TCAGATAAATCTTTGATGCGTATGACCACAGACCGTGTGCCAAACACAAACGCACTTTAA
AAAGAAATTGACCTACCTTTAGGTATTATAGTTAAACCTTATGGTGACCTCCCAACTGGC
GAGGAGACTCCTGCAGTGTCATTTGGGTAAAAGCCAATAGTAAGATGCAAAGATTGTCGT
GGTTATGTAAATCCTTTCATTAGATTCATTGAAAATGGCATGAAATGGATATGCAATATC
TGTGGAGATATAAACCCTACAGACAATTATTACTATTCACCCTTGAATTCAATGGGCTAA
CGTTAAGACTACGAAGATAGGGTTGAATTAAGGAAGGGATCAGTGGATTTTGTTGCGAGT
AATGAATATATGAACAGGCCTCCGATGCCACCTACTTACGTTTTCGTCCTTGATGTATCT
AAACCAGCAATTGATACTGGATACTTAGCTCTTGCAGCTTCAACCATAAAAAGTGTAATT
GAAAGCAAATTGCTTCCTGGAGGAGAAAGGACAAAGATTGGTTTTATTACTTATGACTCT
AGTGTGCATTTCTACAACTTGAGATCAACACTTAAACAACCATAAATGTTTGTTACAACA
GATATTGATCAAATCTTTTTACCTCAACCCGATGATCTATTGGTAAATTTAACAGACAGC
TATGATTTGGTGATTAATCTTTTAGACAATCTACCATCATATTTTGCCAAGACTTAGATA
ATTGACAACTGCTTTGTAGCAGCACTTTAAGCAGCCAATATGGTGGCAAGCGCAATTGGT
GGAAAACTTATTTTCTTCTAATTAGCACAAACTATAATCAAACATCCAATGCTTGCACCA
AAGACTTTACCTAACACAGCAGAAAGATTAGATTTAGTAAATTCAACAAATCCTTATTTC
TCTAACACCGGTTCAGAACTAGGTCATATGCATATGTCATGTGATTTGTTCATCTTTACT
CATGGCAAAAATTAATACAAAAATCTACAGACATTTGCTGATTTGGCCAGAAAAAGCAGT
GGAAATCTATATTACTATCAAGACTATTTAACAGCTACACAAGGTCTTAAATTTAGTAAT
GAACTTTATCACAGTTTAGTGAGGAGAGTTGCTTGGGAGGGTGTTTTTAGAATCAGAACA
TCTTAAGGTTTTAATCAAATCAGATCTTTTGGAAATATTCAAATAAAACATAAGACAGCT
GATCTTATACTTTGTCCTTCAATTGACGCTGATAGAGTCTTAGTTTATGAAATTGAAAAG
AATGACTTACTAAACGAAGATCCTAATAGAATGGCAAGAAGAGATAATTCTCATTTATAC
ATTCAAACTGCCTTACTTTATTCAACATCTGAGGGAGAAAGAAGAATCAGAGTGCATAAT
ATCGCAGTTCCTCTTACAAATATGAAGCACTTACCCTTTGAATATATTGATGTAAATGCT
ACAACTCATTACTTTGCTAGAGCAGCCCTCAATATATTGTAAACGAATTTGAATTTCACA
GTATGCAGAGGCATGATTGAAATGAACCTGACTAAGTTATGCAGATCTATGTTGAAATCC
CAGCAATCAATTAAATAATCACTCCCAGACAATTTACAATACTTAGTGTTATACGTACTT
GGACTTCTAAAGTCTCCATTTATGACACCATCAAAGCAAATCTTGCCTAGTGACCATTTA
GATCAATTGAACTACCTTAGGTTTATCGTAAATGGCATGAGTCCTGAGGAAACTCTCCCA
CTTTTCAACCCCTAAATCATAAGCATTGCAGACTATAACTTGAATGATTAAGTTTTTCCA
GCTCTTGAAAACCTAGACAGAGCTTCTATAAAAACCGAGGGAATTTATATGTGCTATAAT
AGTCTCGCAATATATTTCTATGTGGGTCGTTAGTGTGACCCATATTTCATTCAGACAATA
TTTAAGGCTAATGATGTCAATCATATCAATAGAAATATCTCTGAAGAAGAAATTTTTGCA
GGCTATGAAACTTCTCCATACTTGACATCTCTCTATGGTTTAGTAAACTAGTTCAGATAT
TAAAGACAACCTTATGTTGAGCTCAAGGTACTAGTAGAGGGAGATGCAGAGAGCGAACTA
ACTTTAAGAAGCATGCTAGTAGTAGATAATCTAAATCCTGGTTATCCAATGGATTTCACC
AAATTCTTGGCAACCATTACTGGTGGTGGACCCATTGGGCCAGGAGCAACTACAGGTGGG
GCACCAGCTGCTTATTATTGA


>Contig903.1.g86(protein)
MMSYQRNINNQGAAGYNQPPPTTGGLNKNQNVQGAASQQQNYYQQEGANGYGGSNQQQNL
GGAVGGGQQQNDNLYNQAQSDQYYQTDQNEQQYYDGSQQQQYDYGEEDYSGAYAGQQQVP
DQQYQNSAGAAGYATTAQSRTNVGAGSGTGAAQFYQTQPSTQTPQTNAVGFQSQSQNMVS
QQNTQHYSSVAATTSLEEFNSDKSLMRMTTDRVPNTNALQKEIDLPLGIIVKPYGDLPTG
EETPAVSFGQKPIVRCKDCRGYVNPFIRFIENGMKWICNICGDINPTDNYYYSPLNSMGQ
RQDYEDRVELRKGSVDFVASNEYMNRPPMPPTYVFVLDVSKPAIDTGYLALAASTIKSVI
ESKLLPGGERTKIGFITYDSSVHFYNLRSTLKQPQMFVTTDIDQIFLPQPDDLLVNLTDS
YDLVINLLDNLPSYFAKTQIIDNCFVAALQAANMVASAIGGKLIFFQLAQTIIKHPMLAP
KTLPNTAERLDLVNSTNPYFSNTGSELGHMHMSCDLFIFTHGKNQYKNLQTFADLARKSS
GNLYYYQDYLTATQGLKFSNELYHSLVRRVAWEGVFRIRTSQGFNQIRSFGNIQIKHKTA
DLILCPSIDADRVLVYEIEKNDLLNEDPNRMARRDNSHLYIQTALLYSTSEGERRIRVHN
IAVPLTNMKHLPFEYIDVNATTHYFARAALNILQTNLNFTVCRGMIEMNLTKLCRSMLKS
QQSIKQSLPDNLQYLVLYVLGLLKSPFMTPSKQILPSDHLDQLNYLRFIVNGMSPEETLP
LFNPQIISIADYNLNDQVFPALENLDRASIKTEGIYMCYNSLAIYFYVGRQCDPYFIQTI
FKANDVNHINRNISEEEIFAGYETSPYLTSLYGLVNQFRYQRQPYVELKVLVEGDAESEL
TLRSMLVVDNLNPGYPMDFTKFLATITGGGPIGPGATTGGAPAAYY