Identifiers and Description

Gene Model Identifier

Contig9028.0.g2

Standard Name

None

Aliases

Contig9028_0_g2

Description

FKBP-type peptidyl-prolyl cis-trans isomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00254 ) FKBP-type peptidyl-prolyl cis-trans isomerase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004211503.998777993244535e-41peptidyl-prolyl cis-trans isom
erase, FKBP-typ...
SGDYNL135C6.997498932278805e-30FPR1 SGDID:S000005079, Chr XIV
from 372226-371882, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9028.0.g2(coding)
ATGTTTGCTAGAAAGAATCTCTTATTGATTGTGCTTGCACTTGGCCTCGTCTCCGTATTG
GCTAACACTGAAGGTTTCAAGGTTGAGAAGCTCAACGAAGGAACTGGTCCAAACCCAACT
AAAGGCCAAACTGTCAAGGTCCACTACACCGGTAAGCTCACCGATGGTTCTGTCTTCGAC
TCAAGCGTCACAAGAGGTCAACCATTCCAATTCAAATTAGGCGTCGGTCAAGTTATTTCA
TGCTGGGACTAAGGTGTTGCTCAACTCCAAAAGGGTCAAGAAGCCGTTCTCACCTGCCCA
TACTAAATGGCTTATGGCGAGAGAGGTCACCCACCCGTTATTCCAGCCAGAGCAACCCTC
ATCTTCGAAGTTCAACTCCTCGACTTCTATTGA


>Contig9028.0.g2(protein)
MFARKNLLLIVLALGLVSVLANTEGFKVEKLNEGTGPNPTKGQTVKVHYTGKLTDGSVFD
SSVTRGQPFQFKLGVGQVISCWDQGVAQLQKGQEAVLTCPYQMAYGERGHPPVIPARATL
IFEVQLLDFY