Identifiers and Description

Gene Model Identifier

Contig8855.0.g51

Standard Name

None

Aliases

Contig8855_0_g51

Description

Papain family cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000835002.000555387360374e-52Papain family cysteine proteas
e containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8855.0.g51(coding)
ATGCAAACAGCCGTCAAGCTCGCCGTTATCGGTACCGCATCATTCGTAGCTGCACACCCA
GTCAGCCAAGAAATGGTAAACGCAATTAGATCATCAAATGCCCTCTGGACCCCAACTGAG
GTATCATAGAACAAATTTGCCAACTACACTGAGGCTTAACTTAAAGGACTCCTCGGAACA
GTTCTCTCACACTAATCAGGAATTTCAGCTTTCACTCAAATCAACGCTGCACTCCCAGAC
TCTTTCGATTCCAGAACCTAATGGAAGGATTGTGTCCACCCAATCAGAGATCAAGCTTAA
TGTGGTTCATGCTGGGCTTTCGCTGCAGCAGAGTCTCTTTCAGACAGATTCTGCATTGCC
TCATAAGGTAAAGTCAACCTTGTCCTCTCACCACAAGATATGGTCTCATGTGACACCAGC
AACTTTGGCTGTTTTGGTGGTTACCTTGACTAAGCTTGGTAATATCTTGAGTAATAGGGT
GTTAGTTCAGATTCATGCGAGCCATACAAGTCTGGTAATGGAGACCAACCATCATGCCCA
ACTAAATGCTCTAATGGTCAAGCCATCAAGAAGTACAAGTGCAAGGCTGGTTCAACCAAG
CAAGCTAAGGGTGCAGAAGCAACCAAGAGTCTTATTTAAGAATCTGGTCCAGTTGAGACC
GGATTCACAGTCTACCAAGACTTTTACAACTACAACTCAGGTGTCTATCACCACGTTACC
GGTGATGCTGAGGGTGGACACGCCGTCAAGATCCTTGGTTGGGGAAAGCAAGGTCTAGAA
AATTACTGGATCGTTGCCAACTCCTGGGGTGAAGATTGGGGAGAAAAAGGGTACTTCAAC
ATCAGACAAGGAGACTCAGGAATCGACGAAGCCACCTTCGGTTGCATTCCAGACGTCTCG
AGCGCTCTTGAGAACGAATTCATTCAATGA


>Contig8855.0.g51(protein)
MQTAVKLAVIGTASFVAAHPVSQEMVNAIRSSNALWTPTEVSQNKFANYTEAQLKGLLGT
VLSHQSGISAFTQINAALPDSFDSRTQWKDCVHPIRDQAQCGSCWAFAAAESLSDRFCIA
SQGKVNLVLSPQDMVSCDTSNFGCFGGYLDQAWQYLEQQGVSSDSCEPYKSGNGDQPSCP
TKCSNGQAIKKYKCKAGSTKQAKGAEATKSLIQESGPVETGFTVYQDFYNYNSGVYHHVT
GDAEGGHAVKILGWGKQGLENYWIVANSWGEDWGEKGYFNIRQGDSGIDEATFGCIPDVS
SALENEFIQ