Identifiers and Description

Gene Model Identifier

Contig8740.0.1.g10

Standard Name

None

Aliases

Contig8740_0_1_g10

Description

3'-5' exonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006304301.9998745702418095e-483'-5' exonuclease family prote
in
SGDYOR001W2.9998215087698487e-30RRP6 SGDID:S000005527, Chr XV
from 326832-329033, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8740.0.1.g10(coding)
ATGGCTTGGGTTCAAAGAAGAAACAACCAATAATTCATTAGCAACAAAGTGTTAACATCA
AAGCAAAGACTTTCTCATGAAGTTTATTTCAAGCCCTAAATAAATTAGCATTCCCTTAAA
TATGATGACATGAGAAGAAATGTCTTGTAGGCCATGTCTACAAATGAAAATGTAAATAAA
GGCATAGAATTCAATCACAAAATTTAAGATGACATTAAATTCCAAGAATTCAAAGAAGGG
GACTATCATTATATAGATACGCCTAACAAGCTGCAAGAAATATTGAGGAGTTTGTACAAG
TACAGTGTTTTGGGAGTTGATTTAGAAAACCATCAAACTAAATCGTATCATGGCTTTTTA
TGTTTAATACAGATCACTACCCCTGACTATTAGACATATCTCATTGATTGTCTTAAGTTG
AGAGAAGAAATTAAAACTTATCTTGGAGCTATTTTTGAAAGTCATACTACCCTGAAGATA
TTCCATGGCTGTGTAAACTCTGATATAACTTGGTTACAGAGAGATTTTGGATTTGCTACA
GTTAACGTTTTTGACACGTAGGAATCTTACAAAAAGCTATTTAAGGGTTAGAGAGTATCC
TTACTACATTTATGGACTACCTACTGCAAGGATAGAGTGAAAATTTCAAAAGAATAGAAA
AATATGTTTTAAAAAGCTGACTGGAGTATGAGGCCACTCTCATCTGAAATGCTAAACTAT
GCTGCTCATGATTCACATTATTTAATTTATATTGCAAAGCGATTACAGAAAAATTTTGAA
AACCAAAATTAGCTTTAAGAATTAGCTGATATTTGCAATTAAGTAAATATTTAATGTGTC
TCCCAGCTATTCAAACCTAGAGATATTACATTTAATAAAGATGAGGAATATAAAACGCCA
TTCAGAAAAATTCTTGATGGTTTTGATCCAGAGAGTGAAGAGTTTTTGCTAACTGAGTAC
ATCTTCAAAAGAATTTATAATTTGAGAGAGCACCTAGCTTAAATAATCGATGTAACACCA
AGTGAAATTTGTGATGATTCTATGCTCTATGTTCTAAGTAAGAAAAGACCTATTGAATAC
TAATAGACTAGAAATATGTTAGATGAATAAGGAAAGAAAACTACAACATATTTCAGATCA
ATCATAGAGAACTTAAATATTGAAATTGAGTAGGCAATTGATGATTTTCCCAAAGAGATA
GATTCAATGAAAGAGTACTATTCAAAGTTGCCAAATCATGGTTGGAACTCTTAATAAGAA
AGAATGAGATAGAAGGAAGAGAGAAAGAAAAAGATTATTAAACATTACTCTTGCAAGAAA
GTAGTATATGAAAACTGTAAAATGGTCGCACCTGATGGTGAGCTGCTTTCTAACTGTGAC
TTTAAAAAGGCTTAATGGTACATAGAGAAAGGTTTAGGTGAAAAAATATCAGATAATCCT
TTTACTATAAAGCTTATGTTTGAACCAAATGGGAGAGGAAAAGCGAAACCGTTTGAAGAG
CTTTATGACGATAACTTTTATGTCGCTGATAGAGAAAATAAATATAAAATTTCCCAGATA
CATTAAAAAGTCATCGCTCTCATGATGTTGTACTTTTGTGTTTCCCATGCCATGAGATAG
CAAGTAGAGAATAAGATTAGTTGA


>Contig8740.0.1.g10(protein)
MAWVQRRNNQQFISNKVLTSKQRLSHEVYFKPQINQHSLKYDDMRRNVLQAMSTNENVNK
GIEFNHKIQDDIKFQEFKEGDYHYIDTPNKLQEILRSLYKYSVLGVDLENHQTKSYHGFL
CLIQITTPDYQTYLIDCLKLREEIKTYLGAIFESHTTLKIFHGCVNSDITWLQRDFGFAT
VNVFDTQESYKKLFKGQRVSLLHLWTTYCKDRVKISKEQKNMFQKADWSMRPLSSEMLNY
AAHDSHYLIYIAKRLQKNFENQNQLQELADICNQVNIQCVSQLFKPRDITFNKDEEYKTP
FRKILDGFDPESEEFLLTEYIFKRIYNLREHLAQIIDVTPSEICDDSMLYVLSKKRPIEY
QQTRNMLDEQGKKTTTYFRSIIENLNIEIEQAIDDFPKEIDSMKEYYSKLPNHGWNSQQE
RMRQKEERKKKIIKHYSCKKVVYENCKMVAPDGELLSNCDFKKAQWYIEKGLGEKISDNP
FTIKLMFEPNGRGKAKPFEELYDDNFYVADRENKYKISQIHQKVIALMMLYFCVSHAMRQ
QVENKIS