Identifiers and Description

Gene Model Identifier

Contig841.0.g97

Standard Name

None

Aliases

Contig841_0_g97

Description

ABC transporter transmembrane region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005582309.997093137033517e-262ABC transporter family protein
SGDYLL015W9.997093137033517e-262BPT1 SGDID:S000003938, Chr XII
from 116432-121111, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig841.0.g97(coding)
ATGGATCAATAATAAAGTGATAAAGAAAAGGAAGAATTGCTTCTGACAAAAGATTAGACT
AAGCCCTTAGAAGTATCTCCTCCTCAATTCCTTTGCGAATAAAATGTCAGAGATATGGGT
TTATGGAAAAAATTGTTTTTCTCTTGGGCAAACCCACTTATTGCTTTCTCAAAGAAAAAC
GTTCTGCATATCAATCAAATGGGGGATATAAGACAAAACCAAAAGGTTGAGGTGTAATAT
CTTAAACTTAAGAAAAGTTGGAAAAAATATAAACATTCATAGGGAAACGCCCTTTTCAAA
GCTGTAATTCACGCATACAGATATGAATATTTGATTGCTGTCTTCTTCAATCTATTAATA
ACAGCAGCCGAAATAAGCACTCCTTTTCTTGTCAAGAGAATAATTGAATTCATCTAATCT
ACAGATGATGATGTGGGATATGGTTTTGGGCTAGTATCGATCCTAGTAGTAACATAAGGG
CTATAATACATAATCAACGATCACATTGATTATTATCAAAGATTAATTGGAGTTAGGTCA
ACAAACGCGCTTATATCTATGATCTATAAGAAAATTTTAAAGGTGTCGAGTGCTACAAAC
AAAAAATTCTCAAATGGAGAGATTGTGAATTTTATACAGGTTGATGCTTAAAAACTCAAC
ATCATATCTGAAAATCTGGCTACAGTATTGAAGTTGCCAATTATATTGGTGACTTGCATA
ATCTTGCTATTTTACTTTATTGGTGTAGCATTCTTTGCAGGTGTCGCTGTACTTATTGTG
GCCTTTGTTATGAACTTATTAGTTAGTAGATATGCAGCCAAGATCTAAACTAGTTACATG
AAATATTAAGATTAGAGAGTGAACTTAACAACTGAATGTTTGAACAACATTAAAATGCTT
AAATTGTATTCTTGGCAAGAGCCCTTTGAGAAAATGATCTCAGAAAAGAGATAACTTGAA
CTCGATACACTTTGGAGGAGATTTAGATTTGGTATGGTTAATACTACCTCACTATATTTT
TTCCCCTCAATTTTGGGATCAGTGGTCTTTTCTACTTATATTGGAATGGGAAATACTCTA
GAACTCAGCGTTGCTTATACAATTACTACTATCTTCAATCTTATAAAACAACCGCTACTC
TGGCTTCCAATTTTTATTGGACTTGTTATTGAATTTACTGTGTCTATGAAGCGTATTCAG
GATTTTCTACTTTGCCCGGAAATAAACAAATCAGTTGCTAAAAAGATTGATTTTGAAGAA
GACGATAAGTATTCTATTACAATTAAAAATGGAAATTTTCACTGGGGACTCATGAATGAA
AAAGATAAAAAAGAACAGATTAAACATAAAAATAAAGGAAATAAGTAAGTAAAAAGTAAA
GTCAATCTTGAAGAAGCAAAACCTTTAATGATTGAGGAGGAGAAGAGAAATGTTAGTCAA
GTTTTGGCAATCAGAAACATAAATCTAGAATTCAAACATGGGGAGTTCATTTGCATAATA
GGAGATGTGGGGTCTGGTAAAAGTTCACTGTTAAGTTCAATTATAGGGGACTTATTATAC
CTAGACCCCTCATTCTTGAATTAGTATAGAGATGCTCAATTAAATGAAGAACTTATAGAA
AAGATCAAGCAAGAATCTGCTAAATTTATTGATCCGAGAGACACTCCAATCATTCTTTCT
GAAGATGTAGCGTATGTGCAGTAAAATCCTTGGATTTAGAATAAAACTATCAGAGACAAC
ATTTTATTTGGCTTGCCCTTTGATCAAGATAGATATGAAGAGACCATAGATATCTGTGAG
TTAGCACGTGATCTAGAAATTCTTCCTTCAGCTGATATGACTGAAATAGGCGAGAAGGGT
ATAAACTTAAGTGGTGGCTAAAAAGCTAGAGTGAGTTTAGCAAGAGCAGTATATTCAGAT
AAAGCAATCATGCTTATGGATGATCCTATCTCAGCTTTAGATGCCAATGTCAAAAAGAAA
ATATTCCAAAATGTTTTCATGGATAAATTCAGGAATAAAACCAGGCTCTTAGTCACTCAT
GCCATAGATTTTTTGCATCTTGTTGACAAAATCATTGTGCTTTCTAAAGGAGAAGTTATT
CTTCAGGGAAGCTATGATGAAATCAAAGAAAATCCTTATTTAATTGAAATCATAGGTATT
CACAAAGGTCATTAGGAAGACGCAACAAACATGGTTGATTCAGGAAAAGATAAGAGCATT
GAAAAATCTTAGAATATTTAAATATCTGATAAATCAGATGACGATAGTTTATCGTAAAAT
GACTCATCTAGCAACCTTTCTTCATCCGACAACGAAATCAGTGATGGAGAAGAAAGTAAT
AAAAATAAAAATGATACTAGAAAGGGAAGAAGGGTTAACAGTAAAGCTAATAGATCGTTT
TCTATGACTTCTTTGAGTTCGGCAAATCAAGGTAAAATGATTCAGGATGAGAATATAGAA
GAAACTAAAGTTGGATTTGATGTTCCCTTAAGATATCTGAAGTATTTTGGAGGCTGGAAA
GTCTTTATCACTCTAATGTTCATTTTTGTGGGTTTTACAAGTGTTAAGATTTTATCAGAT
TATCAAGTTGGTAATTGGGCAACTGCAAAAGATTAACAAGAAAACTTTTCATTTTACTGT
GGATTGAGTTTCTTGTATGCCTTTCTTCAATCACTTTTCGTATTCTTCCGAGTTTATCTT
ATGCAATATTTCTCTTGGTTTGCCACTAAAAACCTTCATTAAGATATGATCAAGTCTGTC
CTTAACGCGCCAATAAATTTGTACTTTGATGTAACACCAATAGGAAGAATTCTCAATAAA
TTTTCAAAAGATCTCTCTACTTTAGAGCTGCAATTAGCCTGGCAAGTCGGTTCATTTTTC
GTGCTATTTTTCCAAGCACTTGCAATTATAATCTAATCAATCATAGTTGTGTATTGGATA
GTTATTCTAATAATCTTTTTGGGTATTTTAGCAGTAAAGCTTTACTCTCACTCAATAGGT
TCCTATAGAGAGACAACTAGAATTGAAAGTTTAACTAGAAGTCCCCTTCTTAGTTTTATG
AGTGAAAGTTGTTCGGGAGCTTCCACTATTAGAGCATTTGGGAAACAGAAATAATTCATA
GTAGAGAATAACAAATTACTCAATAAGAATATTTTGGCTGTCACTTGGCAAGCAGGAACA
GCCTAGTGGTTCGCTCTAAGACTTGATTTACTATCAATTGTTATATTGGCTTTTGCGACA
TTTTTCTGCATTATCAATAGACACTCAGTTGACAGTGTTTTTCTTGCAATGCTACTTTCT
AACATTTTGTTACTACAAGATTTTGTTCTATACACTCTCAAGATTTACGCAATGTTAGAA
GCTAGAATGGTGAACGTGGACAGATGCCTGAAAGTTCTTGAAATCCCTTAAGAATAAAAT
AAACCAGCTGATGATAGATTGAATTTCTTTGATGCTAGACCTGACTGGCCAGAGTCAGGG
AGGGTTGAATTTGAAAGTGTCTATCTTAAATACAGACCAACAACTGAAACTATACTAAAA
GATCTCTCATTCGAAGTGAAGCCAGGTGAAAAAATAGGTATAGTTGGCCGCACTGGTGCA
GGTAAGAGCACAATATGTTTATCACTCCACCGCATAATGGAAATCTCAAGTGGTTACATC
ATGATAGATGGAGTTGACATAAAAGAATTAGAACTGCACGAATTAAGGAAGCGCATTACA
GTTATTCCTCAGGATCCTACTATGTTTACTGGAACTTTGAGATTTAACTTGGATCCTGAG
AATCGCACACCTGACGACAGAATTATCGAGCTACTCAAAGAAGCTAATCTAGAAGATATG
ATAAACAAAGATCCAAAGGGAATTTACCAAGATATAGCAGAGAATGGGTCAAATTTGAGT
AGTGGAGAGAAACAACTACTATGTATTTGCAGAGCAATTTTAAGAAGAAGTAAAATAGTG
ATCCTTGATGAGGCAACAGCAAACATTGATGTAGTGACTGAGTAGAAAATACAGAGATTG
ATTTAACTGGAATTCAAAGAATCAACAATGATAACTATCGCACATCGACTCAATACAATT
ATCCAGAGTGACAGAGTTCTAGTCCTGTCATTTGGTCAAATCAAGGAATACGATACTCCA
AAGAATTTGATGCAAAATCCTGACTCTGAATTCACAAAACTACTGAAACAAATACAAAAA
GAAGAGGGAAAGACTGATATACCATTGGAAGAATTGGAATCAATAACTGAGTAGAAGACA
GTGCAGTGA


>Contig841.0.g97(protein)
MDQQQSDKEKEELLLTKDQTKPLEVSPPQFLCEQNVRDMGLWKKLFFSWANPLIAFSKKN
VLHINQMGDIRQNQKVEVQYLKLKKSWKKYKHSQGNALFKAVIHAYRYEYLIAVFFNLLI
TAAEISTPFLVKRIIEFIQSTDDDVGYGFGLVSILVVTQGLQYIINDHIDYYQRLIGVRS
TNALISMIYKKILKVSSATNKKFSNGEIVNFIQVDAQKLNIISENLATVLKLPIILVTCI
ILLFYFIGVAFFAGVAVLIVAFVMNLLVSRYAAKIQTSYMKYQDQRVNLTTECLNNIKML
KLYSWQEPFEKMISEKRQLELDTLWRRFRFGMVNTTSLYFFPSILGSVVFSTYIGMGNTL
ELSVAYTITTIFNLIKQPLLWLPIFIGLVIEFTVSMKRIQDFLLCPEINKSVAKKIDFEE
DDKYSITIKNGNFHWGLMNEKDKKEQIKHKNKGNKQVKSKVNLEEAKPLMIEEEKRNVSQ
VLAIRNINLEFKHGEFICIIGDVGSGKSSLLSSIIGDLLYLDPSFLNQYRDAQLNEELIE
KIKQESAKFIDPRDTPIILSEDVAYVQQNPWIQNKTIRDNILFGLPFDQDRYEETIDICE
LARDLEILPSADMTEIGEKGINLSGGQKARVSLARAVYSDKAIMLMDDPISALDANVKKK
IFQNVFMDKFRNKTRLLVTHAIDFLHLVDKIIVLSKGEVILQGSYDEIKENPYLIEIIGI
HKGHQEDATNMVDSGKDKSIEKSQNIQISDKSDDDSLSQNDSSSNLSSSDNEISDGEESN
KNKNDTRKGRRVNSKANRSFSMTSLSSANQGKMIQDENIEETKVGFDVPLRYLKYFGGWK
VFITLMFIFVGFTSVKILSDYQVGNWATAKDQQENFSFYCGLSFLYAFLQSLFVFFRVYL
MQYFSWFATKNLHQDMIKSVLNAPINLYFDVTPIGRILNKFSKDLSTLELQLAWQVGSFF
VLFFQALAIIIQSIIVVYWIVILIIFLGILAVKLYSHSIGSYRETTRIESLTRSPLLSFM
SESCSGASTIRAFGKQKQFIVENNKLLNKNILAVTWQAGTAQWFALRLDLLSIVILAFAT
FFCIINRHSVDSVFLAMLLSNILLLQDFVLYTLKIYAMLEARMVNVDRCLKVLEIPQEQN
KPADDRLNFFDARPDWPESGRVEFESVYLKYRPTTETILKDLSFEVKPGEKIGIVGRTGA
GKSTICLSLHRIMEISSGYIMIDGVDIKELELHELRKRITVIPQDPTMFTGTLRFNLDPE
NRTPDDRIIELLKEANLEDMINKDPKGIYQDIAENGSNLSSGEKQLLCICRAILRRSKIV
ILDEATANIDVVTEQKIQRLIQLEFKESTMITIAHRLNTIIQSDRVLVLSFGQIKEYDTP
KNLMQNPDSEFTKLLKQIQKEEGKTDIPLEELESITEQKTVQ