Identifiers and Description

Gene Model Identifier

Contig836.1.g142

Standard Name

None

Aliases

Contig836_1_g142

Description

PWWP domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig836.1.g142(coding)
ATGAGTACGCAAGTCGGAGGCCAGAATGGCAAGACTAGAGCTTCAAAAGAGTCCTAGAAA
TTTAGAGATGGAGAAATCGTGTGGGCAAAAGTGAGAGGATACTCTTGGTGGCCTGCAAAG
ATTGGCAAGAAGGAGAACAACGGAGACAAAGAGGGGAAGTATCGAGTAAACTTCATCGGA
GATAAGACCTATCAGGATCTCCCAGAAGATAAGTTAGCTGATTTCATAAGCAATTACATA
GATTATGCAAAAATTAAGAAGAGAGATCTCTAAGATGCGATAGAGTAAGCCAAAAAGTTG
CTAAGTTAGGATGAATAGAGTGCAATTGAGAGACTGTTGAGGAATGAAGACACCAAGGCC
AAGTAGAGTGAAAAAGGCGGCAATAATGAAAAAGTTGATGTGGAGAAGGAAGAAAAGATC
AATGTAAAGCAGATCAGGGGATCTTAGATTCTTACAAGCGCAAAAGGATTATAACCTGAT
ATGATTAAATAAAGCGTTGCAAAGAGCACTGCCATATCTCATAGCAGTTGCGACCACTCC
ACGACTCCAACGAAGGCATCGGCCAAAGATTTGCAAATTTCATCTTCGAAAGGGTCATCT
TCAGCTAAAAAATAAGATCAGAGTAGCATCACTAATATAAGAGACTAGGCTCGCACTTTA
GTGAAATAGAAAACCCCTGTTATGAATAGAAGGAATCTAAAGACCCTCCAGAAGCAGAGT
GCAAGAGATCGCAAGTATACGAAGGATAGTAGATCCGAAGGAGATGCCTCACGAGATTTA
ATTGATGAAATGGAGGATGAAGAGAGCCAGATCATTTGTACAAAGTCAAAAACTTTGTCA
ATTAACCATCGTAACAAGAGGCTTAAGAAAACTGCTAAGTTAGAATCAGATGCAGAAAGC
GAAGTTCAGGAAGTTTAGAATAATGATATCATGCAGGTAGATCTCCCGCATGATGAAGGA
GAACAAGAGGATAAAAAGGTTCTTAATAGTACTACCCAAATAGATGAAGATACGCATAAT
AATTAAATAATAGGAGGGGATCAAGAAGTTATGAAAGTGGATTCTAGTGAAATAGAAGAA
TGCAAGAGTGAACAATCCATATTTGAAGAACCATCTTGCCATAAAGATGTTTAAGAACCT
CTGCCTAAGGAGAGACGTCAATCAGCTCAGCAGGCAATAAAAGTGATACAAAGCGTTACT
ACAAAGCAACCAAAGAGTTTGTCTAAGAGCAAAATTATTGAGAAAAGATAGACCATAGAC
AAGCCTAGGACTCCATAAACCAAGACTGGGGATAGTTAGAAATAGAACAGTCAACTGGTT
AAAATGTCATCATAGAAGAATCTTTGTTAAACTAAACCTCAGACTTCTTCGGGATCTGAT
TCCACAAGACATAGTCCATATACAAACATTCATCAGGGCAACAAATCTTTAAAGGGAGTC
AGCTAATCCGTTAGCAATATTACTGTTCAAAATTAGGCATCCCATATTTAAAGTGCTACT
CAGTGTCAAGTTACTAAAGAATGCACTCAAATAAGCAAAACTATTAGGAATATTATCAAG
TTTTAGCAGTAAGAAGAAGAGTAATTCAGGAAAAAGAATCAATTGGACAAGTCCTAAATT
GACATATTAGCAGAGAACAAAGAGTGCCTGTTGATGATGCAGCAGTAAGTTCCAACACTG
TACAAGCATTTAATGTAACTCTAAAAGACTGAGATAACTCTGAAAATTCTTGAAGATACT
GGCATTGCTAAAACACTCAAGTATTTATCTGACTATTGTGAACTATACAAGAGAGAGATT
CCACCTCTCTAATCCATATTCTAAAACATTCAAGCCCTCTTGCTCAAGTGGAAAAATTAT
GTTACGAAGTAATTGTTTGAGGAGAAGAGTTCACATATTGAAGATTTTTAGAAAGAGAAG
TACAGGCTTAAAGTAGAAAAGCTAGAGAAGAAATCCGGAGCCAAGAATAAATCATCAAAT
ATTGTGCAATAAGACCTAAGTTACGAAGATAAGTAGGTACCCTAAACTACAAAAGCAAAT
GCATCCCTTTCTAAAATAACAGAGCAACAGTAGAATCAGCAATTGATCTAGAATTTTTAA
CAGCATTAGATTCTTCATTAACTATCCTAAGCTTAGATAATTAGCGATGACGAATTTAAA
AATAATACATTGCTCTAATAGAAGCTTGATCTACTCAAAAGACAAAGTTCCTAAAATGCA
CAAACTTCTAATAATGGTATCAGAAGCATTCTTCTCCAGGCGGCTTTAAATAGTAGCAAT
AACAGGCAGTAGTAAGAAGGACTTGCTAGAAAGTTTAGCACTGATTCACAATATACAAGG
ACCATACAGAACCAACAAAGCGAAGAGAAGTTGTAGTAGACTCAATAGTAATACTAGCAC
TCAAATTCAGGCACCTATGAGTCAGGAAAAGATTTATAGCAGAACCTTACTTAGATTCCT
TAGCTCCAATAACCCCAAACAATACAACCTTAGTAGCAACAACCATTGGCACAGCAGTAG
GCATTAGCTTTAGGTTTAGGTAACTTATAACTCGATAATATTTCTAGCATTGCTTAAATG
CTCCTGCAGAATATCTATAATAATAACCCAATAAATAAGAATGGCAGTCCTTCAAGATAG
CAGATCCTAACTGGCTTCCAAAGGCCTACTCACTCAAACTTCTTGTTAAGAGACATCAAC
CCCCATTAATAGTAATAATAAAATTAGAATGAGAACGATTAATTAAAAGACAACATCGCT
GCTCAGTTCACTTGA


>Contig836.1.g142(protein)
MSTQVGGQNGKTRASKESQKFRDGEIVWAKVRGYSWWPAKIGKKENNGDKEGKYRVNFIG
DKTYQDLPEDKLADFISNYIDYAKIKKRDLQDAIEQAKKLLSQDEQSAIERLLRNEDTKA
KQSEKGGNNEKVDVEKEEKINVKQIRGSQILTSAKGLQPDMIKQSVAKSTAISHSSCDHS
TTPTKASAKDLQISSSKGSSSAKKQDQSSITNIRDQARTLVKQKTPVMNRRNLKTLQKQS
ARDRKYTKDSRSEGDASRDLIDEMEDEESQIICTKSKTLSINHRNKRLKKTAKLESDAES
EVQEVQNNDIMQVDLPHDEGEQEDKKVLNSTTQIDEDTHNNQIIGGDQEVMKVDSSEIEE
CKSEQSIFEEPSCHKDVQEPLPKERRQSAQQAIKVIQSVTTKQPKSLSKSKIIEKRQTID
KPRTPQTKTGDSQKQNSQLVKMSSQKNLCQTKPQTSSGSDSTRHSPYTNIHQGNKSLKGV
SQSVSNITVQNQASHIQSATQCQVTKECTQISKTIRNIIKFQQQEEEQFRKKNQLDKSQI
DILAENKECLLMMQQQVPTLYKHLMQLQKTEITLKILEDTGIAKTLKYLSDYCELYKREI
PPLQSIFQNIQALLLKWKNYVTKQLFEEKSSHIEDFQKEKYRLKVEKLEKKSGAKNKSSN
IVQQDLSYEDKQVPQTTKANASLSKITEQQQNQQLIQNFQQHQILHQLSQAQIISDDEFK
NNTLLQQKLDLLKRQSSQNAQTSNNGIRSILLQAALNSSNNRQQQEGLARKFSTDSQYTR
TIQNQQSEEKLQQTQQQYQHSNSGTYESGKDLQQNLTQIPQLQQPQTIQPQQQQPLAQQQ
ALALGLGNLQLDNISSIAQMLLQNIYNNNPINKNGSPSRQQILTGFQRPTHSNFLLRDIN
PHQQQQQNQNENDQLKDNIAAQFT