Identifiers and Description

Gene Model Identifier

Contig8346.0.g10

Standard Name

None

Aliases

Contig8346_0_g10

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004976606.002077021906841e-60hypothetical protein
SGDYBR198C1.999790113608142e-24TAF5 SGDID:S000000402, Chr II
from 618523-616127, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8346.0.g10(coding)
ATGAACAAATTTGAAAAGAAAAGATTGACCAAACAAAACGACTATCAAGTGACTAGTGGA
GCAAAGATAACTTGTGCTAAATTTGGAGGTCAAAATTATTAGCTATTAGCTGCAGGCGAT
GATCAAAGAAACATAAATCTATGGAAATTAAGCAAAAATTTACCCAAGCTGGTAATAAAT
GGTCATTCAACTGGAGTAAGCGAGCTTTAATTCAGTGGAACTGCAGAATAAATTTATGCA
GGAACATTTGGAGGCACTATTCACGTTTGGGACTTAGCAAGCAAAAGAGAAATTGCAAAA
TTATAAGGTCACATGACAAAAACTACCTGCTTAAACAGTGATTAAATGGGAGGAACTGTA
TTAGTTTCAGGTTCAGAGGACACCAAAGTAAAAGTTTGGGACTTAAGAACAAATAAGTGC
ATTCAAACTTACAGAGAGCATACTGGAGTTTTGAACAGCGTTTAATTGTCTCCAGATTCT
AGATGGGTTGCTTCTGGAGGAGAAGATGGTACTTTAAGAATATGGGATATTGCCTCAGGA
AAAACTTTACAAACTTTCCCTATAGCTGGATAATCAATAACTTGCATTCAATATAACCCC
TAAAATTTAGCTTTAGCTAATGGCTCAACTGATAGAACTGTGAAGTATTGGGATTTGGAG
CAGTTTTCAAGCATCAATGTTACGCCATAAGATAGTTCTCCAATAACAAATTTGACTTTT
GATGAAGACAGAAATGCAGAATTCTTATTTGCAGCTTCAAATGAAAGCATAAAACTATGG
AACATTGAAACGAATAAGTTACTGGATTGTTTGAGCATTATTCCTAAGAACATCTCTGAT
CTGAGAATAGCAAGCGAAGAAAGATTTCTTTAGATGTCTGCTCTTTCAAACAATACTATA
TCAGTTTGGTATGCTCCTTTAGAAAGTATAAACTATGATGATACAATTGACACTGTACCT
TCAAGTGACTCATTAAAATCCTAGTAAGATTAGCATATGATGGCTGTAATGCAACCACAA
AAATCAAATTTCGTCAAAAGCTAACAAACTTCTGAAGAAATTGAAAGCCAAAGATCAAAA
CAGCTAAAAGAAAATCCATTTGCTAATGTTTAACCAAAGTAGGATCCCTAATAATTCTAA
CAAGAGAGAAAACCCTCATTAAAATAAGTAAGTCAGGTAAACCCTCAATAAATGTAGTAG
CAATAAGAAGATACCGAAATGCAAGATTTATCTAGGGCGACTTATGTTAAAAGTCCTTAT
GACAAACCAATTGGCATTGACATGAATAGTTTTGATGTAGATAAAAGTTAAGCACCACAA
AAGAGAGATTTAGAAATTATTAATGAATGCATGGGCAATCATGCAACTTTGGTAAGCGTT
ATGTAGAGAAGAACAAATCAAGTAAACATAATTCAAAATTGGTGGACCAAGGGAAATATA
ACATCTGCTATAAATGCCCTAAATATGATGAATGACACTAGCACTGTCATGGATGTGGTG
AATAATACTTTTGCTGAAAATTAGAAGGTAGACATCCTAAACTATGAGAATATTTCAACA
ATAACCACTCACTGTGTCACTCTTGTCAACAGCAAATATGAAACCCATATTTTAGCTGGT
TTAAAAGCTATCCTCAACATCTTAAAACACTGGGCTCCATAAATGATTCAAATTAAGACT
GTACCAGTTGGAAGCGGTGTAGATTTGGCAAGAGAAGAAAGATTAAAGAAAGTTGATACT
TGTATTGAAAACTTCAAAAATTTCTATAAATGCAAAGGATTCCAGAAATCTCTTCAGAGA
GAAGGTGAAGTTCAAGAAATTGGCAAAATGGTAAATAATCATCTTACAAACTTACTAAAT
AAAACTGGAAGAGAACTTGAAGCAGATTGA


>Contig8346.0.g10(protein)
MNKFEKKRLTKQNDYQVTSGAKITCAKFGGQNYQLLAAGDDQRNINLWKLSKNLPKLVIN
GHSTGVSELQFSGTAEQIYAGTFGGTIHVWDLASKREIAKLQGHMTKTTCLNSDQMGGTV
LVSGSEDTKVKVWDLRTNKCIQTYREHTGVLNSVQLSPDSRWVASGGEDGTLRIWDIASG
KTLQTFPIAGQSITCIQYNPQNLALANGSTDRTVKYWDLEQFSSINVTPQDSSPITNLTF
DEDRNAEFLFAASNESIKLWNIETNKLLDCLSIIPKNISDLRIASEERFLQMSALSNNTI
SVWYAPLESINYDDTIDTVPSSDSLKSQQDQHMMAVMQPQKSNFVKSQQTSEEIESQRSK
QLKENPFANVQPKQDPQQFQQERKPSLKQVSQVNPQQMQQQQEDTEMQDLSRATYVKSPY
DKPIGIDMNSFDVDKSQAPQKRDLEIINECMGNHATLVSVMQRRTNQVNIIQNWWTKGNI
TSAINALNMMNDTSTVMDVVNNTFAENQKVDILNYENISTITTHCVTLVNSKYETHILAG
LKAILNILKHWAPQMIQIKTVPVGSGVDLAREERLKKVDTCIENFKNFYKCKGFQKSLQR
EGEVQEIGKMVNNHLTNLLNKTGRELEAD