Identifiers and Description

Gene Model Identifier

Contig80.0.1.g111

Standard Name

None

Aliases

Contig80_0_1_g111

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002985102.0009605191578312e-25small GTP-binding protein doma
in containing p...
SGDYFL005W0.0000000000000299873730555305SEC4 SGDID:S000001889, Chr VI
from 130334-130981, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig80.0.1.g111(coding)
ATGATTGATATCGCCGGCTAAAACATCTTCAAAGAAATCACCTTTGAACTTCTTGGAAAA
GCTAACTTAATTATGTTGGTCTATGACGTGACTAACCCAGACACGTTCCATCTCTTGAGA
CAATGGCTTGAGGGTATCAAGCAACAAAACCAAGGAAAGCAGTTAAATGGAGTTGTAGTA
GCAAATAAAATTGACTTAGAAAATAGAATTGCTGTAGGCCCTCAAGATGGTTTGGCATTC
GCAAAGAGCATCGGTTTCGAGTTCTTTGAAGTGAGCACATTACAAGGCAAAAACATTGAA
GATCCCTTCCAGTGTCTCGCTGAAATGTTCTTCAGTAAATACTAAGAGAGATGCGCTTAC
TTGCAAGACATGTGA


>Contig80.0.1.g111(protein)
MIDIAGQNIFKEITFELLGKANLIMLVYDVTNPDTFHLLRQWLEGIKQQNQGKQLNGVVV
ANKIDLENRIAVGPQDGLAFAKSIGFEFFEVSTLQGKNIEDPFQCLAEMFFSKYQERCAY
LQDM