Identifiers and Description

Gene Model Identifier

Contig7971.0.g57

Standard Name

None

Aliases

Contig7971_0_g57

Description

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam00512 ) His Kinase A (phospho-acceptor) domain
  • ( pfam00072 ) Response regulator receiver domain
  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam13188 ) PAS domain
  • ( pfam13581 ) Histidine kinase-like ATPase domain
  • ( pfam13426 ) PAS domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009207905.000307300873256e-47ATPase, histidine kinase-, DNA
gyrase B-, and...
SGDYIL147C0.0000000020002373268528243SLN1 SGDID:S000001409, Chr IX
from 73453-69791, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7971.0.g57(coding)
ATGTAGTAATAAAGAAAGAACGAGGCAGCACGAAGAGGCGGGCCTAGACAAGAATCCTAA
GTTTAACAACCATCAGAATATGAGGACATTAAAGATAACAGATCGTAAAGCGATACAAGT
GCTGAATAAAAAAAGGCGTTTAAACATTTAGTTGATCACGTGGCACCTCATGCGGAGATC
TCTAAGTTTTCCTAGAGGTTTAAGGATCCAGCATTGTACATGTTGGCGGTTGTGATAATC
ACTCTTATTTATTTGGCTTACTTGATATACAGGGAATATAAGTTTGAGCATGCGCCCTCG
ATTGCTATTTCAATACCTATAAATGTGGCATTTTTTCTTTCTTAAATCATCGTATATTTC
CTGGCAATGAAATATCAGTTTTTCTAGTTAAACTTCTCAAACATTGAAGTGATATTGTTT
CATGTTTTACTTCTGGAAATGAGTATAAATGCTGGCACAAGAAATGTATACGCTTATATA
TTCAAAGAAATTCCTGTAATCTTTTTATGTCGTGCGAGTTACAACCAAATGATATTTTAC
ATGTGTTTAATACTGTGCTACTTGTACAACGTATTCCGGTCTTACTCATGGATTGATGAT
TCATATATTTATAGCATCTATGTGGTTGAATACTTTTTCTTCACTTTCATCTGCATAATA
ACAGCAAGACTTTCTAACAAAAAAGAAAGAGAGATGTTTCAATCTCTTATCATGTAAAAG
TAGTTGACACTGGTATTTCACAATTTAATTAAAATATTTCATGATGGCGTTGTTATAGCT
GATAAGGAAAGGATTTTATACCACAATGAATAAAGTCTTAGAATTTTTGGGGTATCAACT
GAATAATAAGGATTTCAATCGAACAGAAGTCTTTTGAGCTCCCAATATAGATCAGGTAGA
GAACTTATAAGGCGCAGAGTGAGCGATGAATAAAGAGGCTAGCAACCAAATTAAGACTTA
GAAAATCAATCTAATACGGATAGTCTACCTCATCTATTGCAATTATAATTAAAGGAAGCA
GTAATAGATAGGGAGGAATGCAAAAATCTTGGAATAGACATTGATAATAATTTCAGATTT
AGGTTTAACACTCTTGATGAATATCTCTCAGAGAGATTCAGCTATCAAGTCAACAGAGAA
GTGTTACCATTAAGAGATAATCTTAGATAATAATAAGAGCTGGGAGGTGGGCATCTCTCA
AATGAAATGCTTTGTCAAGAAATTAATATGGAAGGGATACCATTTTAAATTTAACAAGAT
TAAAATGAAAGAGGGGAGGCTAGGGGCACTGGTCGAAATTAAAATATAACAGAGACTAAA
CATATTTAAGTATTCACTCAGTCTATGACTTGTAATGGAAAAGAAACAATACTGATCGCC
CTCCGTGACATGACTTCTTGGATTGAAATTGAAAGATTTCAGAATCTGAACAAGATGAAA
ACCATACTTTTTGCCTAGGCGGCCCATGAATTTCGTAATCCTTTGAACGGGATTATTTCT
TCTATAGATATCCTCCATGACTAAATTAAAACTGAAATTGGAATGAAATTCTATAAAATA
GCCAAGAACTGCGCTAATTTGATGCTATTTCTAGTTAATGACATTTTAGATTTCGCACAA
ACTGAAGAAAAAAAGTTAGTACTAAATACTGAAAGATTTAAGCTGAAAGATTTAATCGAT
TAATGCACAAACATGTTACAATTTTCAGCTGAATTAAAGGGTTTGAAAATAATTACCGAG
ATCGATAAATCTACTCCAACTTATTTCATTTCTGACTAAAATAGATTACGTTAAATTATG
ATAAATTTGCTCTCAAATGCAATAAAATACACTCGCAAAGGTTATATAAAGATTAAGACT
TCTTATATCGATAGATAGATTCTAGAAATTAAAGTTCAAGATACAGGAGTTGGCATTAGT
CAAGAGTAAATAAAAAGCTTATTTAAGGTTTTCACTAAAATTATGGAAGATAGAGAGTTA
AATCGATAAGGATGTGGCCTAGGTTTGTCAATTAGCAAGAAACTAGCAGAAGCTTTAGGA
GGAGATATACTTGTAGAATCTGAGAAAGATGTTGGAAGTACTTTTACTCTTTAAATTTCT
AGTCTTGAAAGTTAAATGAAGCCTTCTTTTTCTGGCTAGAGCAACTCGTCTCATCCTAAA
ACCAATAAAAATGCAAATAGCTAAATTAATAGTAATAATAATCTAAATAATCAAAATTAA
AACTTCAACTCGAATGGCCATGCAATTTCCTCATTTGATCCGAATCGTCCAAAAGATCAT
ACTTGTGACATATAAAGCTTGAACTCTCAACCACATCATGTGAATGAAATAGGGATGACT
TTCCCAACTAAAAAGAAAAACAAGGCTTTTCATTGGAATGCGAGTTAATTTTCAGAGTAA
ACTACTAATAGAAATAACTCAATTAATTTGCCTTTCTTCTAAAAAATTATGGAGACTGAA
GAGAAAAAAAGAGATGAAGATGGAATCAAAAGTGAGCAGTTTTCAGAAGTTAGACTTCAG
ATAGATGAGCATGATAACTTAGCATTGTCAATGAATAATAACTTGTTGAATGACAGTTTA
TATTTGGATTCAAGATATGCCCAAGTGCTCATTGCAGATGACCAACCATTTAACTTGATG
TCACTTGAGGTGATGTTAGAACAGCACGGCCTCACAGTTGATAAAGCTTTTGATGGGGAG
AGTGCCTATTAGAAAATTCTTTCAGATTAGAAAAAGAGAAATAACTCTGGAAGAGGCTAT
AAACTCATTATCCTTGATAACGAGATGCCTCTAATGAGTGGCTTATAAGTAGCTATAAAA
GTGAGACAAGGTTAAAGATCAGGTGCCTTAGATAAGTCTTTAAAACTAGCCCTATCTTCA
GGGGAATCTTCAAATGAATTCAATAAATTGCTTTATAATCTTAATGATGGCAAGGATCCA
TTTGACTATAATATAGGAAAGCCTGTTAATATGAAGGTTGTCATTAAAATGCTCAATTAG
ACTGGTCTATCTAAGGATAGAAGAGTGCCTAATGATTGA


>Contig7971.0.g57(protein)
MQQQRKNEAARRGGPRQESQVQQPSEYEDIKDNRSQSDTSAEQKKAFKHLVDHVAPHAEI
SKFSQRFKDPALYMLAVVIITLIYLAYLIYREYKFEHAPSIAISIPINVAFFLSQIIVYF
LAMKYQFFQLNFSNIEVILFHVLLLEMSINAGTRNVYAYIFKEIPVIFLCRASYNQMIFY
MCLILCYLYNVFRSYSWIDDSYIYSIYVVEYFFFTFICIITARLSNKKEREMFQSLIMQK
QLTLVFHNLIKIFHDGVVIADKERILYHNEQSLRIFGVSTEQQGFQSNRSLLSSQYRSGR
ELIRRRVSDEQRGQQPNQDLENQSNTDSLPHLLQLQLKEAVIDREECKNLGIDIDNNFRF
RFNTLDEYLSERFSYQVNREVLPLRDNLRQQQELGGGHLSNEMLCQEINMEGIPFQIQQD
QNERGEARGTGRNQNITETKHIQVFTQSMTCNGKETILIALRDMTSWIEIERFQNLNKMK
TILFAQAAHEFRNPLNGIISSIDILHDQIKTEIGMKFYKIAKNCANLMLFLVNDILDFAQ
TEEKKLVLNTERFKLKDLIDQCTNMLQFSAELKGLKIITEIDKSTPTYFISDQNRLRQIM
INLLSNAIKYTRKGYIKIKTSYIDRQILEIKVQDTGVGISQEQIKSLFKVFTKIMEDREL
NRQGCGLGLSISKKLAEALGGDILVESEKDVGSTFTLQISSLESQMKPSFSGQSNSSHPK
TNKNANSQINSNNNLNNQNQNFNSNGHAISSFDPNRPKDHTCDIQSLNSQPHHVNEIGMT
FPTKKKNKAFHWNASQFSEQTTNRNNSINLPFFQKIMETEEKKRDEDGIKSEQFSEVRLQ
IDEHDNLALSMNNNLLNDSLYLDSRYAQVLIADDQPFNLMSLEVMLEQHGLTVDKAFDGE
SAYQKILSDQKKRNNSGRGYKLIILDNEMPLMSGLQVAIKVRQGQRSGALDKSLKLALSS
GESSNEFNKLLYNLNDGKDPFDYNIGKPVNMKVVIKMLNQTGLSKDRRVPND