Identifiers and Description

Gene Model Identifier

Contig7822.0.g32

Standard Name

None

Aliases

Contig7822_0_g32

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000821901.9999391735788327e-19hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7822.0.g32(coding)
ATGATAAAGTAATTATAAGATCTTACCATTTGGAATGACCCTAAGTTATTTGATGTTTCA
CTATATGACCTGAAATCCAAATATGACGATGTAATTGCCCCAAGATCTTCAGGAACTTAG
TTTTTTCAGGATAATCTGTTCACTTTAAAGAACTACGTTGAATTGCACCAAAACATGATA
AGCTATATTTTCACAGTTTGTGAGCACAAAACCCAACCAGATTTTGTCAAGTTTCAAAGT
GTATCCTTGCTGCAAAGATATCTCAAAGCCAAAAATTATTCGTTAAAAAAGGAAAGAATG
TAGCTGATTGCTTTATCTTGCATACTTTTGGCTTCAAAGTAATGTGATGAGGAGATTTAA
ATAAAGAAAATTCATAAATATGCAGGCTATTCGTTTACCAACCAAGATTTCTCAACTTGC
CAGCTAAAAATTCTGAAAAGTTTGAATTTTAAGTTGGTAAACTTAGCAGACGACATATAT
GGCTACACTCAGCTATGCTTACTATCCATTAAATCTCTACTCCCAAATGATGAAAATGTG
ACATTTAACTGGCTACAAGGGTTTTCCATAAATATCTTGGAAATGTTGTACTAAAATAAC
TAATTCTTTCATAGTTATTCCATCCCTGAACTTGCTACTGGATTGATTTAAACGTCAATC
ATTATTCTCAGTAAATTTGCAGGAGCTAGTCCAATAACTCTAAGATTATCAAACTTCACA
AGGGTGGATATAATAACAATTGAGAAAGTATCTAAGAGAATGCTCAAACATGTACTTGGA
GAGCATATCTACAATCAATTCAAGTTTTGA


>Contig7822.0.g32(protein)
MIKQLQDLTIWNDPKLFDVSLYDLKSKYDDVIAPRSSGTQFFQDNLFTLKNYVELHQNMI
SYIFTVCEHKTQPDFVKFQSVSLLQRYLKAKNYSLKKERMQLIALSCILLASKQCDEEIQ
IKKIHKYAGYSFTNQDFSTCQLKILKSLNFKLVNLADDIYGYTQLCLLSIKSLLPNDENV
TFNWLQGFSINILEMLYQNNQFFHSYSIPELATGLIQTSIIILSKFAGASPITLRLSNFT
RVDIITIEKVSKRMLKHVLGEHIYNQFKF