Identifiers and Description

Gene Model Identifier

Contig7751.0.g11

Standard Name

None

Aliases

Contig7751_0_g11

Description

Ubiquitin fold modifier 1 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam03671 ) Ubiquitin fold modifier 1 protein
  • ( pfam04110 ) Ubiquitin-like autophagy protein Apg12

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001938609.999142814001536e-47hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7751.0.g11(coding)
ATGGAAAATACTCTACCTGCTGAGCAAACTGAAGAACAAAAGAAAGACGTGACTCAAGAA
GAAGAGGTTCCAAGTCAAAAGGCAATGCAATAAAAAATCACATTTAAGATCACTAATGCA
TCAGATCCAAAGCTCCCATACAGAACTATCTCAGTACCAGAAAGCGCCCCATTCAGTGCA
TGTGTGAAATTCGTAGCTGAATAATTCAAAGTTAACTCTGCCACTACTGCTATTATAACT
AACTCAGGAGTTGGAATCAATCCTTAATAAACTGCTGGAACAATCTTTTTGAAGCATGGA
TCTGAGTTGAAGATGATCCCAAGAGATAGAGTAGGTTCAATTTGA


>Contig7751.0.g11(protein)
MENTLPAEQTEEQKKDVTQEEEVPSQKAMQQKITFKITNASDPKLPYRTISVPESAPFSA
CVKFVAEQFKVNSATTAIITNSGVGINPQQTAGTIFLKHGSELKMIPRDRVGSI