Identifiers and Description

Gene Model Identifier

Contig7662.0.g96

Standard Name

None

Aliases

Contig7662_0_g96

Description

Nup133 N terminal like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08801 ) Nup133 N terminal like
  • ( pfam00368 ) Hydroxymethylglutaryl-coenzyme A reductase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007604600.00000000006996681903814525hypothetical protein
SGDYBL079W0.0007003012208360162NUP170 SGDID:S000000175, Chr I
I from 75259-79767, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7662.0.g96(coding)
ATGAATATTCCAAATAAGCCCACATCTTCCACTTATTAAACTCAATCATTCAAGCCTGGC
AAAACTTTTGCTCCTGCAACCTAGTCAAACAATCTCGCTTAGCCTAAGCCAAACCCATTT
GACTAACGTGGACAATAATAGCAATAGTCTCGCTCTCTGATAAGAGAAAGTGGGAACTTA
GTTACCCCGAAACCTCAGAGTTACTTTTAGTAAAATAAATCCATGATCAATCCTGGGCCT
CTCTATCCCAAGCAAAATTTAAACATGGTCTCTCCAGCATTTTCCAATACTTTTGCTAAA
GATAGAGCCTATCAGCTAAATTAACAGCAAAAGAGAGGTTACTCAGAAATTTCTAGAAGT
GGACTGAGAGATCAAAGTGTTTATAAGACTCCTTATGATGAATTTGATGACAAAAGTACC
ATCAAGCCCGCTATTGAAACAGTGGTGAGAAATCCCACTTTTAAGAGTCTAGGATTTGGC
CATGGCTAGAATCCCTCTCAAAGGATTAATAAAAGTATGAATATCAATCCCATGAACTTG
AGCCAGACAGATTTCAGTAAGATTAGAAGAGACTCAAGCATGTTCAGATAAGAGAATCTC
GAGGAAGAGTTTAATGATGATGATTTTTACACAGCCAGGAAACATAATTTGAGCACTTTG
CCTTAAACTCAGTAAATTTTCAGCTAACAAGAAATTTCTCATAAAGCTTATAGTAAGAAG
GAAATCAATGTAATGTGCGAGTCAGCATCTTAACTTCTCGGCTAGGTAGCTGACATCGAT
GCAGATCCATTTAAGAATGATATCTCACTCGTGAATTCTCAGGGTCTTAAATATGAATAT
GCACCTTTTCAGTATATCGTGACCAATTAGTATAGAATCCCCAATCAAATCCTTAAAGCT
ATGCAAGATGCAAAAATGAATCCAAGTCATTAGGCATACACTGATTTCGGTATATTTGAA
GATATCTAGACAGCTTACTTCATCTTTAATAAGCAACTATTTCTGTGGTCCTACAGCTTT
GGAATAGGCATGGATGGTGTATAAATAAGATCAAACATTCAAGGCATTCCTGAAAGACTT
GAATTCAACCAGATTGTCACATCTGTATAAGTTTGCCATCCTCTCCCTGAAATGATGCAA
AAGCTTGTATCTACAGATAGAATTCTGGTAGTTGCTACAATTACTGAGATAAGGATTCTG
GATACCGACTATTAAATACCCACTGATAATAATTAGATCTATAAAATAGCATAATTCAAT
AAAAATGGGAGAATATTTTATGGAGGTCAAGATGGTCACATCAATGAGTTGAACCTAAAG
CAAAACACATTTGATTCTTTCATATCAATTGTTAATCCAAATAGGAAGAGGCTAAAGAAA
AATGATCTGCAAAAAGATAACATAATCTCTAGATTAATCCCTAACTTTTTCAAAGCAGAT
TTTAGAAAGAAGATCAAAGATATAAAGTTTGATACTTCTAGAAACTACCTCTATTCTTTC
TGTACCTCCCTTGAAGAACGATCTCTAGGCTAAGCAGTCATAGAAGTTTTTGACTTAGGT
AGTCTTGGCAATGAATTCAGGAAAGTATGTTAAATCAATCAATACCAAATTGTAGAGAGA
TTGCTTGAATTCTAAAATAGAACTATAATGGGGAAAGGTTATGACATTTATGAAGTCTCC
AAGGAATTCAATATTGTCTTAGTACAGCCTATTTTATTCAGTCAGAGTAAAATTTTTCAT
TTGTTAGTTGTCACTCAAAATGGACACAGAATTTACATCTAATTCTAAGAGGATGTTTAT
GACAAAGTAGTCACAGAAGAAGATTTAGAAAAACCAGACGCAGTATTCGATTTCTTAATT
TAACACAGATTTACTCATAGATGGGAAATAGTTTCGGTTCTTGAGCTCCCAGATGAAGAG
TCAGTAGAGGATCATTTAGATGAGGCTATATAAAAAGGCATTTATAAAGTGTACAATATG
ACATCAAAATCCCAAAAAAGTTACCTTGATAGCGAGGGCATTGCTTATGATACTCTCGAA
AGCACTTTAATCTACTCTTAAAATAATAACTAGTAATTAGAATTTGATCCTGACTATCAA
AATATTAGGAGTCTCTGTTTGAATTTTATCAAGAAAAATGAGAGTACTTATTCTCACATG
AAATATATTCAATAAGCTGGTCAAAATTATCAAAATTTAGAGAATTACACATAAACTCAA
ATAATAATAGATGTTCCTAAAATGAATCCAAATTAAATAAACCAACAGAATTTTGTAAAC
GATGACTTTAGCTATCAACAAAATGAACAAATTTTTGAAATAAAGACCATGAATTCATAT
CAAGGTTAATTTTCCACTCCAATCTATAGCTACTTGAGTATCGGAGAATTAGAGAGATAA
GTTCATTTGCAATAGAAGAGAATACAAATTTTAACAGATCATAGAGTAATTGAAATTCAG
CAACTTAGACCAATTGATCATCTAGTCATGATTCTTCATTCCTTTTAAAAGACTGGCTCT
GATAGTTAAGTTGATTTCGAAGATTTCGCTGATTTCTTCCCTCTAAAAGAAGTCTGTACT
ATGCTTGTACAAATAGTTTCAGACACAACTGCCACTTATCTTTTCTCACAAAGAGTTGAA
AGTTTAATTGGAATTTCAAGAAGTAAATCTAAGAGAAATGCGATCAGCTAACCTAGATAA
ATGAGAAGCAACGTTGGAGGCTCAAAAAGTTCAATGTTTTAGTCCCCATTTGTTGCTAGG
CATTCGATTCACTCATAAATGCAGTTGGACTAAAGATCAAGCTTAAACTATATTAAGTTT
TCAGGCCAAGATATTTAGAAGAACTATGTTGTGAGGACATGCACATAGGAAGTTAGATAA
ATTGCTTTCAGCTTTTTAGTGGTCTATGGTGATACTTTGGGTATTGATATTCCATATCAA
ATAGATCAAGAGTAAATTTATGGTCTGCCAATCTCTCCTCTATAATTTTCAAATAAGCAT
TACGCACTTTATTAATATTTACAAAGAATTATAAGACCATTTTGGTACATCAGAGTTTTA
TATCCACATACGCAAGGAAACTCTAAATTATACTAACTTACTTTTGAATCTCTCTAAGGA
GTAAAATTGAAATTAGCAGGTCTTTTGGCAATGATTAAATAGAATTATGTTCAATTTTGT
GGGCAAACTGACTAGTATTAGTTAAGCGAATAACACAATTAACAGGAGATTTAAATTCAA
GGCAACATCATTTTTGATTAAGTGAAATTGGTATCTGAATTAAGTCATGACGAATAAAAA
TAATTGGAAACTATGGAGAGGAACTCATTAAACAACCTTATATTACTCTTAAATAGAACT
ATTGAATCTATTAACCTACTTGACATTATCACATTTGAAAATGATGCAAAGATGTTCTTT
AAACTGTGGAAAAAGCTTGGAAAAGCTCAGCAATTAGAATTCTAAGAATTGGAATTCAAA
GATCTCGTCAATACATCTCACAACACTCTCATTAAGAAAATTCTTGAGGCTTCTATTGAA
TTAGATCAGGATAAAGATTCAGGAAGAACCGCTTAGATAATCAGAGAAAGATCTATTCGA
ATCAACAATTTATGCAGTGCTCTATTCACTATCGAAGAAAATAAGGCATTTGTGGGAGAA
AGTTTGATCTCTACTGCAGTGAAAGAATAAAACCAACAAAAAAGAGAAGAGCTTTTAAAA
CAAGCTATGTTTTCTTTGTGTGAATAACCTCTAGAAATTGACCTTACTATACTAGCTCCT
TTACTGGTTGAGATTGGAAATTTCTCTAGTTTAGTTGATTTGACTCTTCGCAAAATATCA
GCCCTTAATAATTTGAGTGAAATTCAAAGAAAAAACATTGATTAATAAGAAGCTCAAAAC
ATGCGTGATCAATGCTATGAGATTATTCTTCAGCTATTCTCAGCAATTGACATTAGCATT
AATAACTAAACTAAAGAATTTGGACTTTAACACATTTCTGATAAGGAAAAAGATCTTCAA
AAAATATTTATCAGAAAGTTGAATTAGATATCTGGAGTAGAAAGGAAGCTACAAATATTA
AAAAGAATTATGACCAGAATAGAGCAATTCAACGATTAACTTATTTTAACAAGTATCTTT
AACTATGTAATCTCAAAACCTAGCGGAAAATATTCGATTGATGTACTTCCCTATATCAGC
AAAGAAGCCTTCGATACAATTTGCAGTGATTTAATGAAGGATAGGTATATAACAATGGAA
AAGTTTGAGTCAATGGTCAAGATTCTGTCTAAGCAATTAGATGCAGAGAGACTAAGTCAT
TTAGTCCTAAATGTTTGCACTCAAAAATAACAGATACAAAAGGCATTAATAGATACTAAA
GGTCAAGAACAAATTTTTATAGAAAATCTAACCATGAAACAAAGAGAAAGCTATTTATCA
AGAGTAGAAGTTGTTCTAAATGAACGTAAGAATGAAATGAATTCAGATCAACACACAAAA
TTACTTGGAGATGTTAACAAAGCCATGAATAGTGTCAAGATGCAATTACTCATTCAGAAA
TGCATTGACAACAAAATTCAGGGATTAAAGGAGCTTGTCAAGTTTAATAACTAGCAAAAC
AGAGATGAGTTAAATGAGGAAGTTAAATTGCAAGTTCAAGAACTTGAAAATTAGAGAGTC
AAATTGGATTAGGATTTTTATGACAAGAAAGTCTTAATCAATGATGTCATTGAGTAAAGC
AAAATATATGAGGCCAAGTTGAAATTTAATATTCAAGAAGGTTTGTCGCTCCTATTTACA
CAAGATTTAAGCAAGACTATCTTTAACTATGTGTAAGATGTAATTGAGAATTATAAATAC
TCATATCAATTAGTATTAAAGGAAAACTCAAACATGTTCTTAAACCTCCCAAACAAAGAT
TTTTTGAGAAAGTATCTCATTGATATCTATCAATTATCCAATTTAATTCCTTTTAAAGGC
CAAAAGTAGGAAGAAATTCTAAAATCGTTATAAATTGAAAAGCATTTAGGAGAAACTGTC
TTTTGGATTTGCTAATATGCTATAGAAAATCTGTCAACAAAGATATATCCCTCTGAGTTA
GTCATTCTCTTTGTAGGAAATAATCAGTAAAGATAAAACGTTAAATAGGATGAAATATAA
TTCATGACTAAATGCCTCTGCTTGTTCAAACTTTGGACTGACTTGAATAGCAAATTGTTT
CCAATTAATTAAGAAATAGTTATCAAGAAGCCTTTAATGAATCTCTCATATTCAGAAGAT
CCAAAAGATTTGTTTGTAAAAGATTTAAGCTTGAATGGACTGAGAATTTATGAAGATTAT
ATCATTAAGGAGGTTGAAGTTCTTTACAACTAACAGAAAATTAAATTAGAAAAGAACACT
GATTAATTAATTTCATAAGTTCTTGCTTTAGTTAAGAGAAGATTTACGGACATGCTAATT
TTCCATGGCATCTCTGTTGAAAAGTTGAAAAATTAGTAACCATCAAGAGTTTAAATAAAC
AATCCCCAATTCTCCGTGAGATAGTAACAGCGAGATTTAAGTCAACCAAGATTCTAAGCA
TAAGAAGAACAAAAGCTTAATAGGTCATTCACAGTTTAATAACAACCAGTTTTACAGTAA
AACGTGAATCAATCCGCCTCAAGCCACAACTAAACTTAAACTTTTATACAGTAGTAGTCT
CCCTTTAGAGATGTAAATGTTTCTGCTATACCATAGAACAGAGACTCAAACCCCCCAGGC
TTCAGAATTTAAACTGAGAATAGAGACTTTTCTTTGGGTAGAAGCAATACTTCTTAGGCA
AAGAAGTTCAATCCCAATGAGCCCTTAATAGATTTATTATGA


>Contig7662.0.g96(protein)
MNIPNKPTSSTYQTQSFKPGKTFAPATQSNNLAQPKPNPFDQRGQQQQQSRSLIRESGNL
VTPKPQSYFQQNKSMINPGPLYPKQNLNMVSPAFSNTFAKDRAYQLNQQQKRGYSEISRS
GLRDQSVYKTPYDEFDDKSTIKPAIETVVRNPTFKSLGFGHGQNPSQRINKSMNINPMNL
SQTDFSKIRRDSSMFRQENLEEEFNDDDFYTARKHNLSTLPQTQQIFSQQEISHKAYSKK
EINVMCESASQLLGQVADIDADPFKNDISLVNSQGLKYEYAPFQYIVTNQYRIPNQILKA
MQDAKMNPSHQAYTDFGIFEDIQTAYFIFNKQLFLWSYSFGIGMDGVQIRSNIQGIPERL
EFNQIVTSVQVCHPLPEMMQKLVSTDRILVVATITEIRILDTDYQIPTDNNQIYKIAQFN
KNGRIFYGGQDGHINELNLKQNTFDSFISIVNPNRKRLKKNDLQKDNIISRLIPNFFKAD
FRKKIKDIKFDTSRNYLYSFCTSLEERSLGQAVIEVFDLGSLGNEFRKVCQINQYQIVER
LLEFQNRTIMGKGYDIYEVSKEFNIVLVQPILFSQSKIFHLLVVTQNGHRIYIQFQEDVY
DKVVTEEDLEKPDAVFDFLIQHRFTHRWEIVSVLELPDEESVEDHLDEAIQKGIYKVYNM
TSKSQKSYLDSEGIAYDTLESTLIYSQNNNQQLEFDPDYQNIRSLCLNFIKKNESTYSHM
KYIQQAGQNYQNLENYTQTQIIIDVPKMNPNQINQQNFVNDDFSYQQNEQIFEIKTMNSY
QGQFSTPIYSYLSIGELERQVHLQQKRIQILTDHRVIEIQQLRPIDHLVMILHSFQKTGS
DSQVDFEDFADFFPLKEVCTMLVQIVSDTTATYLFSQRVESLIGISRSKSKRNAISQPRQ
MRSNVGGSKSSMFQSPFVARHSIHSQMQLDQRSSLNYIKFSGQDIQKNYVVRTCTQEVRQ
IAFSFLVVYGDTLGIDIPYQIDQEQIYGLPISPLQFSNKHYALYQYLQRIIRPFWYIRVL
YPHTQGNSKLYQLTFESLQGVKLKLAGLLAMIKQNYVQFCGQTDQYQLSEQHNQQEIQIQ
GNIIFDQVKLVSELSHDEQKQLETMERNSLNNLILLLNRTIESINLLDIITFENDAKMFF
KLWKKLGKAQQLEFQELEFKDLVNTSHNTLIKKILEASIELDQDKDSGRTAQIIRERSIR
INNLCSALFTIEENKAFVGESLISTAVKEQNQQKREELLKQAMFSLCEQPLEIDLTILAP
LLVEIGNFSSLVDLTLRKISALNNLSEIQRKNIDQQEAQNMRDQCYEIILQLFSAIDISI
NNQTKEFGLQHISDKEKDLQKIFIRKLNQISGVERKLQILKRIMTRIEQFNDQLILTSIF
NYVISKPSGKYSIDVLPYISKEAFDTICSDLMKDRYITMEKFESMVKILSKQLDAERLSH
LVLNVCTQKQQIQKALIDTKGQEQIFIENLTMKQRESYLSRVEVVLNERKNEMNSDQHTK
LLGDVNKAMNSVKMQLLIQKCIDNKIQGLKELVKFNNQQNRDELNEEVKLQVQELENQRV
KLDQDFYDKKVLINDVIEQSKIYEAKLKFNIQEGLSLLFTQDLSKTIFNYVQDVIENYKY
SYQLVLKENSNMFLNLPNKDFLRKYLIDIYQLSNLIPFKGQKQEEILKSLQIEKHLGETV
FWICQYAIENLSTKIYPSELVILFVGNNQQRQNVKQDEIQFMTKCLCLFKLWTDLNSKLF
PINQEIVIKKPLMNLSYSEDPKDLFVKDLSLNGLRIYEDYIIKEVEVLYNQQKIKLEKNT
DQLISQVLALVKRRFTDMLIFHGISVEKLKNQQPSRVQINNPQFSVRQQQRDLSQPRFQA
QEEQKLNRSFTVQQQPVLQQNVNQSASSHNQTQTFIQQQSPFRDVNVSAIPQNRDSNPPG
FRIQTENRDFSLGRSNTSQAKKFNPNEPLIDLL