Identifiers and Description

Gene Model Identifier

Contig7655.0.g67

Standard Name

None

Aliases

Contig7655_0_g67

Description

Phosphatidylinositol 3- and 4-kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00454 ) Phosphatidylinositol 3- and 4-kinase
  • ( pfam00613 ) Phosphoinositide 3-kinase family, accessory domain (PIK domain)
  • ( pfam00792 ) Phosphoinositide 3-kinase C2
  • ( pfam10654 ) Protein of unknown function (DUF2481)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006493801.9993404840605158e-133Phosphatidylinositol 3- and 4-
kinase family p...
SGDYLR240W5.000040196085687e-64VPS34 SGDID:S000004230, Chr XI
I from 617533-620160, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7655.0.g67(coding)
ATGCAATACGTGATAGTCCAGTAGGAGACTCCTGCTTAACAAAATGCAAAAGCTTATCAG
AATTAAAGTGGTAATGCTGGAGGATATTATTAATCTACTCAATTCAACCAGTCTGCAGGA
AGTGCAGCTTCAATGAATCAACAGCTACTTGGAGGATAATCTTACACAGCCAATTTATTA
AGTGGTCTCAAAAATTCATCAGATAAGTCAGTATTCATAAGGCATGGAGAAGTCAAAGCA
AATGTCTCGATGGATATCAAAACTATTAGAGATATGAATAACGTTCTTGGATTACTAAGT
GAAAATGAACACGAAGAATTTCTTTTTGCAATAAATGAAGATACTTTAGGTTAGATCTGT
AAATTTCACAACATCTGCAAGAAAGATGCTCTTTTAAAATTACAGCAAGATAAATCTCCT
CTCAAAATAATCAGCAAAAGTAAACCAAACCACAGCATAAAGCTTCAACCATCAGATTTG
TAATAACTTGACTAATAAAATTAAGAGAAACCTACTCAGATGTAACAATAACTAAACACT
TTGAATATATACTTCCAATACTTTGTCGTGGTCGAGCTATCTCTAAATAGTAAAGTCTTT
GAGCCTAAATTTTATACTGGCATACAAAACTCTTTCGAGATCGGAGAGAAAATTATTTTC
CCCTTAAAATATCAAGACCTAGCAAATCTTTCACTGATTGGCTTAACTATTTATGACATG
AAAAAGCCCTATGAAGAAAGTTTAATTGGAGGGTGTTCTATCGACTTATTTGATGAGAAG
CAAAGATTAAGATAAGGCACTTTTAACTTATACATCTGGCCAAAAACCAAAGCTGATGTT
AGTTTACAATCATAAACACCTGGACTGTTTGAAAATCAAAAGCTTAAAGAAATCAATGTT
TTGCTGAATAAGATTGATCTTAATGCTAAAGTACCATTAATTATGGGAAGGCAAGATAAT
AGAGAATGGCTTGATAATTAAAGCAGAGATGCCATAAACTCCCAATTATTTGAACTTTAT
ATCGAAAGTAATTAGGCTTACTTAGAGATAAGCTTTCCAGAATTTGGTAACACTGTAATT
TATGAAGATACTATGAACCATTCTTTAAAAAGTCAATATCTATTTCCACAATAGTAACTA
ATGTAGTACAATTCTTTGTCAAATACTATTAATCCTAGTGAACTGCTGTATCAAAAAATA
TAGTCTCTATAAAATCCAAGTATATAAAATACTGCAAGAGAAGATTCAATCTTTTCTGGT
ATCATGAAATTCCATGACCCACTTATCATGATTAATACTCCTGACTTTTTAAAGAGATCA
AATCCAATCACTCAGAAATATTACATCTTGACAAGAGATATCGATGAAAGCGGAGCTAAG
GACTTGACACCTAATGCTGACGAAACTGAAGCCATTAATGAAATCATAAATTTACCAGAT
TTTTCTACGCTGAGTGTTGAATAGAAGGCTCTTCTCTGGCATTTTAGATATTCATTGACA
AACAACAAGAAAGCTCTTGTAAAGTTTTTGTAGTGCATAGAGTGGACTAAAGAGAAAGAA
GAGCTAGAAGGTGTCAGAATGCTTAAGAAATGGCAAGAAATTGATATTGAACAGGCACTT
CCCTTACTATCGTTCATGTTTTGTGCTAATAGTATTTATCAGCCTCAATAATCCTTTCCT
AACCAGTTTCAAAGATTTAATGAGATTAGAATTGTTGCAGTGAAATGCCTGGAAAAGTAA
CCTTATGAACAAATCAATTCAATCATGCTTTAACTTGTTCAAGCTTACAGATACGAATAT
TTCTAATAGTCTCCATTAAGAAAATTTTTATTGAGTAAAGTGGTTTAAGATGAAAGTATC
GCGAATTGCTTTTAATGGCATGCAATGCTTGAAGCTGGCAATGAAGAAAACGGAGAAATG
CAAAATTACTACTAAGATCTTTACAGAGAATTTAGAGAGTTGCTTAGTTATGAAAATCCT
TAAGTATTTGAGAGCATAAACAAATAGATCAACTTCAGAGATTAGCTATATGAACTAGCC
ACATCCATTAAAGAGAATAAGAAAGAGAAATTCACTTAGAAAAATGAAAATTTGAAGAAA
TTCATATCTAGATCTGGAATTAGAGATATGACTCACTTCGATCCACCAAGGCCAATTCCA
ATCGACCCTAAGATATTTGTAAGAGGTATTGAGCCTTAAGAATGTTTTGTATTCAAATCA
GCTATGTGCCCACTAAAACTCTCTTTTCACTATTAAATCGGAGAAGACGGGTATTAAAAG
AAGAAAGACTAATAAAATAATCAATCTCCGTTATATAGTGTAATGTACAAACATGGCGAT
GATGTGAGATAAGATCAACTAGTACTTCAAATATTAACTTTAATGGATAATTTGCTAAAA
GAGGTCAATTTAGATTTTAAATTTACAGCCTACAAAACACTTGCTTTTTCTACAAAAGAT
GGCATGTTAGAGTTCGTGCCTGGCTCCAAAACTATTCAAGATATATTGAAAGAGAATAAA
AACAGCATTGAAGACTTCCTTAAAGTATTAGCTAAGAATGACGAAAAAAAGTATGACGAG
ATCTTAGATACCTATATTAAATCTTGCGCTGGTTATTGCACAGTTACTTATCTTCTCGCA
GTGGGTGATAGGCATTTAGAAAATTTATTGATTGATAAGTTAGGTCATTTATTCCATGTT
GATTTTGGATTTATTTTTGGAAAGAACCCTCCTGGAAAAAATATTCTAGCTCCGCCTATC
CGTATTTGCAAGGAAATGGTTGAAGGAATGGGAGGTAACACTCATCCCAAATATGAGCTT
TTTAAGAAAAAGTGTGTTGAATCATTCTTATATCTCCGTAACTATCAAAGACTCATCTTG
AACTTATTCCATCTTATGATTCATGCAGGAATTAAAGATCTAAATTTTGCAGAACATTAA
AGAGTGCTGACTGCTATGTACGAGAAGTTCATGCCGAATAAGACTAACATCGAAGCTGAG
AAAGAATTCGTTAATATTATTAAAGAGAGTGTCAATGCTTTCTTCCCTAAGGTCATGGAA
AAATTCCATGTATGGGCTTAGTATATGAAGTGA


>Contig7655.0.g67(protein)
MQYVIVQQETPAQQNAKAYQNQSGNAGGYYQSTQFNQSAGSAASMNQQLLGGQSYTANLL
SGLKNSSDKSVFIRHGEVKANVSMDIKTIRDMNNVLGLLSENEHEEFLFAINEDTLGQIC
KFHNICKKDALLKLQQDKSPLKIISKSKPNHSIKLQPSDLQQLDQQNQEKPTQMQQQLNT
LNIYFQYFVVVELSLNSKVFEPKFYTGIQNSFEIGEKIIFPLKYQDLANLSLIGLTIYDM
KKPYEESLIGGCSIDLFDEKQRLRQGTFNLYIWPKTKADVSLQSQTPGLFENQKLKEINV
LLNKIDLNAKVPLIMGRQDNREWLDNQSRDAINSQLFELYIESNQAYLEISFPEFGNTVI
YEDTMNHSLKSQYLFPQQQLMQYNSLSNTINPSELLYQKIQSLQNPSIQNTAREDSIFSG
IMKFHDPLIMINTPDFLKRSNPITQKYYILTRDIDESGAKDLTPNADETEAINEIINLPD
FSTLSVEQKALLWHFRYSLTNNKKALVKFLQCIEWTKEKEELEGVRMLKKWQEIDIEQAL
PLLSFMFCANSIYQPQQSFPNQFQRFNEIRIVAVKCLEKQPYEQINSIMLQLVQAYRYEY
FQQSPLRKFLLSKVVQDESIANCFQWHAMLEAGNEENGEMQNYYQDLYREFRELLSYENP
QVFESINKQINFRDQLYELATSIKENKKEKFTQKNENLKKFISRSGIRDMTHFDPPRPIP
IDPKIFVRGIEPQECFVFKSAMCPLKLSFHYQIGEDGYQKKKDQQNNQSPLYSVMYKHGD
DVRQDQLVLQILTLMDNLLKEVNLDFKFTAYKTLAFSTKDGMLEFVPGSKTIQDILKENK
NSIEDFLKVLAKNDEKKYDEILDTYIKSCAGYCTVTYLLAVGDRHLENLLIDKLGHLFHV
DFGFIFGKNPPGKNILAPPIRICKEMVEGMGGNTHPKYELFKKKCVESFLYLRNYQRLIL
NLFHLMIHAGIKDLNFAEHQRVLTAMYEKFMPNKTNIEAEKEFVNIIKESVNAFFPKVME
KFHVWAQYMK