Identifiers and Description

Gene Model Identifier

Contig7647.0.g33

Standard Name

None

Aliases

Contig7647_0_g33

Description

Kinesin motor domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003217406.999576669079256e-104Kinesin motor domain containin
g protein
SGDYGL216W3.999458587140588e-43KIP3 SGDID:S000003184, Chr VII
from 84885-87302, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7647.0.g33(coding)
ATGGCTTCAGCTAGTAATTAAAAATAGTATATTCCACCTTCCGATAGCAAAAAATAAAAA
CATGAGAAAGTTGTGGTACATCTCAGATTACGACCACCAAATTCTGAAGAGAAGCAAACC
TCGATAGAAATCTTTGATCCATAGAGAAAATATATTTAAATTAAGAAGGACAGTGTTGAG
AGAAAAACTTTTCAACTAGATTCATTAATGGATCCCTATATTTCATAAGAATAAGTATTT
CATTAAGTTGCTACACCAGTCATTAATACAGGCACAGGAAAAACTCATACTATGGTTGGG
AATTATCATCCCCTACAAAACGATTCTAGAGGTATTATACCACGTAGTTTAGAGTACATT
TTTGAAAAGATTAATTAAAATGGATAAGAAAGCGATTTAATGAGTGCAGGAAGTAGCAAT
AATAATGGATACACTTATGATGTGCAAGTTGCATTTATCCAAATCTACATGGAAATGTTG
TAAAATCTGCTTGATCCAGAGAGCAATGATGTTAAAATTAGAGAAGATCCTTTATAAGGT
GTATTCATTTCAGGCTTGAATTGGATCCCTATAAATTCTACGAAGAAAGGAATGCAGGTA
TTTGCAAATGGTGAGAAAAATAGAAGTACCTCATTTACAAAATTAAACGCTCACTCTAGT
CGCAGTCATGCTGTATTTATGGTAAAGATAGAGAGAAGGAAAGAATTTAAGCTACAAAAC
TTTGACAACAATAAGAAATTTAAAAATTAAGGATCAGTTGAATAAATGACTTAGAGTATG
CTATATTTAGTGGATTTAGCAGGCAGTGAAAGAGTAAAGAAATCTATGGTATCTTAAGGA
AGACTAGATGAAGCAAAAAAGATTAACTTCTCCTTAGCGGCATTAGGAAATTGTATCCAC
GCTTTAACTGAATAAAAGTCCAATAATCATGTTCCATTTAGAGATTCTAAGCTGACTCGA
ATTCTTTCTGATTCACTAGGAGGTAACTCCAAAACAGCTCTGATAGTGACTATAGGTCCC
TCAAAAGATCATGTTGAAGAAACTATTATGTCACTTTAATTTGCACAGAGAGCTATGAAA
GTAGAAAACATTCCAGTAATCAATAAGAAAGTTGACTATAGAGTGTTGAATGTGCAACTA
TAAAGCGAACTAGATGAAATCAATGATAAATTGACTTAATTGCAAATAAGATATTGCTAA
GTCCTCGAGAAATTGGAAGAAACATAAAAAGAGAACGAAAAGCTAAAAGCCTAAAGCAAA
GTCAAGTAGAATCTCAATCAATCAATGGTTAGCGAATCAGATTAAAGCCAGCTGAAACTC
TTTTATGAAGACTTACTTCGCTAAAAAGATGTTGAACATAAGTGTTTCCTAGAAGATATA
GACAATCTAATTGCGACACAAGAATTAAACCTCTAAACCCTAAAACATGAAAATGCCTCT
TTTAAAGAACAACTTTAATCACTTAATTCTCTTGAAAAAGATAAAACTGAGCTTGAAAAT
CGTATTATTGAATTAAGCTAAGATCTAGAGAAATCTAAAAAGATGGAGTAGAAATTGAAA
ATATAAAATACTGTTAAGTAAAGTAGGCTGAGGCAGGAATTCGAGAAGGATAGTCAGGTC
ATTATTACCAAGATGGAAGGGCTTGATCGAGAAATAGAGGCTAAAGAAGAATCAAATCTA
GAACTTTAAAATTCACTAAAACTTTAGATAAAAAACTAAGAACATAAGAATCTTGAAATG
TAGAACAATTTATAAGAAAAAGAGGCTTAAATTAAATTGAAATAGTAGTATATTGATTAA
TTGGATTAGAAAGTCATTAGACTTGAAAGTGATAATAAATCATTATCAGATTTGCAATAA
AATCAAATTTAAGAAAAGTTAGATTTTATAAACGAACTGGAATAATAGAATCTCAAGCTA
AAAAAAACTCTTGATAAGCAATTATCAGATAAAACTACTTCAAATCTCAATCTTGAACAG
AAATTGTTTAAAAATAAGAGAAATTACTAATAAAATATAAAAGGTCTTGAAGATCAAATT
CAAACTCTTTAAAGTCAAATTGATGAAAAATCTTAATAGTTATCATCAAATGAAAAATTG
ATAGCAAAGTAAAATGATTAATAATTAAATCTATAGAATGATTTTTCGCTTTTGCAATAA
AAACAAGACACTCTCAGTGAACAACTATTTCAAAAATAGAATATGATAACTCAACTTTAA
TCATAATAAGATGAAATAAATTCCCAAAACTAAAATCTAACTGAAGATGCTCAAACAGTA
GGTAATTAATTTTTCGATTTGCAATCTCAATATTAAGACTTAGAGGCTTAAATGCAAAAC
TTAAAAGATACCTATGAAATCATGAGCCAGCATGCTAATGATTCAATTTCTGCTTTGACC
CAAGAAAAATAAGAAATTATTGATTAAAACTAGGCATTAATCTCATAGAGAGATGACTTA
TAAATGTAAAGGGAAGAGATGCAAAACTAGAACTAAATACTGTAAAATGAATTGGCTATT
TTGAAAGTTTAACTATAAGAAAAGCAAAATAAGTTAAGTTTTAGCGAAAAGTTAAAAAAT
GAGTCAGAAGAAATTAATGAAGTTAAAATTTCAAATTTAAAGGAAATAATTAAGGACAAA
GAGGAAATTATATAACAATATAACTAAGAAGTTTAAGACTTGCTTGAGAGAGTGAAGGAA
ATGAATATTAATAGAGAGAAAATGGTTCAATAGATATAAAATTTAAAATCATAGAGTGGT
GAGAAGAATGCTTAAATGGATAATGAATTAGAAAATTTGAGGATCTAGCATTAACAAAAT
ATAGAGAGTTTGAAGCAATAATTTGATTCAGCGATATCGTAAATTCAAAAGGATCATAAC
TCAACTATTCAAAAAATAAAAATAAACGACCTATCAATGGGTCTCTCTGAGTATCTCTTA
GAATCTTAATTCCTGAAACTTGAAAAGCAATCTTAATAAGATAAAATCTAAAAACTTGAG
GCTTTAGTAAAGCAAAAACGTGATGCTAGTATATGCTTTTCTACACAAATTTTGAGAGCT
TATGAACAAAATTAACCAAATAATAATCGAGATATTGCGGAACAAGTTTAAGATACAATA
GATTCAATGATAACTATAGTTGAGATAGAGGATATGGTCCATAAAAATTTGAATTATTCA
AGCCATTAAAGTCTAGATTTAACTATGAGTTCAGGTCTAGGGTAAACTATAATTATGCAA
TCTTCGCAAATGTGCAACGCTGATACTACAATGAACTATTTGAATTAGTATATCCTGGGT
ATTCCCACTCTGCCCACATTAAGTGGCAATTTAGTCAAATATCACTAGAAAGAATTATAG
TATAGGGAATACATGAGAGGGTTTATCTAAATGCTGTTGTTTATTAGGAATCACGCTGAG
AGGAAGTAAGAGAAAGATAAGGAGTAAATATCAAAGCTTAAAAAGAGATTGATGAGTACA
CTAAAATAATTTGAATAATATAAACTAAGTCATTAAAGAAAAGAGTAGTTTTCTGGTAAG
CTAGATAGAGCAGCAAGAGTGATTTAAAGATATTGGAGAAAACAAAAAAGTTAATAATTA
ATAAAGGAAAGTAATAAAGTTACTCATAAATTAATTTAAGAAAAAATGCAAGCTGCAGAG
GCTCAATGGCTTTTGGAGGAAAACTAGATTCAGACAGGTAAATTTATGATAAGAAAAAGC
TTGACTTAGGTTGACGACTTTATGTCAATACTAGTGAAAGAATTTATTCATAAAAGAACA
GTTGTTGCACCACTTTAATTAAATCTCGGTATTTAATCTAAGTTCTCTAAGTTGGCATCA
TAAGTAAATTAAATCACCAAAGTTGACAGCAATGTGCACAATTTACATGTCCAGAAAAGA
AAGAATAGCAGCAATAATATGGTTAAAAATGAGTATAGCAATAAAACCAGCGCTCGTAGG
TAGAGCTCTTTAAGTAAAATAGGCAGTTATTTTAACAGTCAAGTGACCAGTCATAACGTC
AGTCTATAAAGTTCACAAATTAAAAATACTTATGGAGATGCTCATGAAAATACTTTTGAT
ACTTAGAATTGA


>Contig7647.0.g33(protein)
MASASNQKQYIPPSDSKKQKHEKVVVHLRLRPPNSEEKQTSIEIFDPQRKYIQIKKDSVE
RKTFQLDSLMDPYISQEQVFHQVATPVINTGTGKTHTMVGNYHPLQNDSRGIIPRSLEYI
FEKINQNGQESDLMSAGSSNNNGYTYDVQVAFIQIYMEMLQNLLDPESNDVKIREDPLQG
VFISGLNWIPINSTKKGMQVFANGEKNRSTSFTKLNAHSSRSHAVFMVKIERRKEFKLQN
FDNNKKFKNQGSVEQMTQSMLYLVDLAGSERVKKSMVSQGRLDEAKKINFSLAALGNCIH
ALTEQKSNNHVPFRDSKLTRILSDSLGGNSKTALIVTIGPSKDHVEETIMSLQFAQRAMK
VENIPVINKKVDYRVLNVQLQSELDEINDKLTQLQIRYCQVLEKLEETQKENEKLKAQSK
VKQNLNQSMVSESDQSQLKLFYEDLLRQKDVEHKCFLEDIDNLIATQELNLQTLKHENAS
FKEQLQSLNSLEKDKTELENRIIELSQDLEKSKKMEQKLKIQNTVKQSRLRQEFEKDSQV
IITKMEGLDREIEAKEESNLELQNSLKLQIKNQEHKNLEMQNNLQEKEAQIKLKQQYIDQ
LDQKVIRLESDNKSLSDLQQNQIQEKLDFINELEQQNLKLKKTLDKQLSDKTTSNLNLEQ
KLFKNKRNYQQNIKGLEDQIQTLQSQIDEKSQQLSSNEKLIAKQNDQQLNLQNDFSLLQQ
KQDTLSEQLFQKQNMITQLQSQQDEINSQNQNLTEDAQTVGNQFFDLQSQYQDLEAQMQN
LKDTYEIMSQHANDSISALTQEKQEIIDQNQALISQRDDLQMQREEMQNQNQILQNELAI
LKVQLQEKQNKLSFSEKLKNESEEINEVKISNLKEIIKDKEEIIQQYNQEVQDLLERVKE
MNINREKMVQQIQNLKSQSGEKNAQMDNELENLRIQHQQNIESLKQQFDSAISQIQKDHN
STIQKIKINDLSMGLSEYLLESQFLKLEKQSQQDKIQKLEALVKQKRDASICFSTQILRA
YEQNQPNNNRDIAEQVQDTIDSMITIVEIEDMVHKNLNYSSHQSLDLTMSSGLGQTIIMQ
SSQMCNADTTMNYLNQYILGIPTLPTLSGNLVKYHQKELQYREYMRGFIQMLLFIRNHAE
RKQEKDKEQISKLKKRLMSTLKQFEQYKLSHQRKEQFSGKLDRAARVIQRYWRKQKSQQL
IKESNKVTHKLIQEKMQAAEAQWLLEENQIQTGKFMIRKSLTQVDDFMSILVKEFIHKRT
VVAPLQLNLGIQSKFSKLASQVNQITKVDSNVHNLHVQKRKNSSNNMVKNEYSNKTSARR
QSSLSKIGSYFNSQVTSHNVSLQSSQIKNTYGDAHENTFDTQN