Identifiers and Description

Gene Model Identifier

Contig761.1.g41

Standard Name

None

Aliases

Contig761_1_g41

Description

Tetratricopeptide repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001552902.000620012690291e-23hypothetical protein
SGDYDR356W0.00000000000006002591555650462SPC110 SGDID:S000002764, Chr I
V from 1186107-1188941, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig761.1.g41(coding)
ATGATATACTATTTAAAAGCTATTATTTTGGTTGGGAATAGCTATAAGTGTCCATCGGAT
TTTGTAAAAACAGCTTGCTCACCCGGAGAGTATAGTCCAATGGGGTCTATAGTTTGCACA
ACTTGTCCCTCTGGATACTATTGCCCAACCACATCTGATCCACCTCAAATATGCTCTGTG
GGCACCTACCCTGCCGCAAACTAGCTTTCATGCACAACATGCCCTGCTGGTAAATATTGT
GGAAGCCCTCTTAGTACCTCCCCAGTAACTTGTACTGCTCCAACATTCTATCAAAGTTTA
ACAGGATAAACAGAATGCCTAACTTGTCCAGCTGGTTCATCATGCACTGCAAGTGCTACT
GCTTAATGTTCTTCTACGAATGGATATTATTCAGTCTTAGGTACTGGTACCTGCTCTTAA
AGTTAAAAGGGTTACTTCACTCCTGAGAGATAAATGAACACTGCATCATGCCCAACAAAC
ACCTACACAAGTGCTGTCGGTTAATATTCTTGCTCTTAGTGTGACTCTGGTTTTAGTTGT
TCAGATTAGATTGGTACAAAAACTGCATGCGCAACTGGTACATTTTCTCCACTTGGAGTA
ACTACTTGCCAATCACCAACCTCTCCTTATATTTATGATACTTCCACATCTGCCATCAAT
AAACCTTGCACAGAAGGATACTATTCAACAAGTAATGCTTGCGTTTAATGTGCTGCTGGA
AAGATATGTAGTGATACTGCCACAGTTAGTAATTGCCCAGTTGGCTAATACAGTACAATT
GGCAAGGGATACTGTATGCCCTGCAAATCATTTTACGGTTGTAATGCACCAGCCTCACCA
GCAATTTGCACAACAAGTCAATACTTAAATCCCATTACTTCTACTTGTACTACCTGTCCA
TTAAATTAAGTTTGCTCTGTTAGTTCACAGAAAGTAGCCTTTCCTAGATTCTGCAGCCCA
GGCTACTATAGAAGTTCAGCTACAGCTTGCACCATATGTCCAGAGGGATCATACTGTCCA
GATGGGAAAACTACTTCAGCCACAGCTTGTGCTACTAAGTACATTTCTGGTACTGGATAC
ACAGCCTGCATTAAGTGCCCTGCTGGTTATGACTGTAATGGAAAAACATATCTGTCATTG
ATTACTAAATGTGCTGCTGGCTACTATTCACTCGAAGGCGATGCTATCTGCTCAAAATGT
ACCACTGGATAAATCTGCCCAGAGACAAATACAGTGTATGAGAATTGTATTGCTGGTACC
TACATAACTTCCACTGGGTCTTCAGCTTCCAAATGCACACTAACTGATGTAAACTACAAA
TCAACTGGTCTTACTTCTTCACCTAGTGCCTGTACTAAGACATAATTCGCTAAGTATGGC
TAAACTTCTTGCACTACATGCCCTACTAACGAACCCTGTTCCATCGATCGTAAGGGTTTC
CTCAGTGATTGTGACCCAGGATTTTCATTTGATTCTGCCACTAATACTTGTAAGTAATGC
ACAGCCGGGAAGGAATGCCTAGATTCAACAGCTACTACATGTCCCAAGGGAACTCTAGAA
AAAGCTGTTGAGAGTTTCTAATGCTTGGAATGCCCAACTCCTATGATCTGCGCTATATCT
GGATCTTCAGTTGTAAATAACTACTGCTATGGTAAAGAATCAGGTGTAACTGTGGTAGTT
GAATTCACAAAAGCCGTCAGACTTCCATACTATGATTATCAATACTGCATTGATTGTAAT
TCAGTCGATCTGAACTAAAAAGTATGCACATTTGCTACAAACTACTTCACTTCCCAAGTT
GGTGCAAATTTGACATGCCCATCTACCCGTTCTAAGAGTTACGATAATACCATAAATGGA
GTTGAATTCACAGATTATAGATATTGGGATAAAACTAACTATGACTACCCATTTTGTGAT
ATTAAGTCTTCAACAACAATTCCTGGCTTCGATCTTGATCCTCCAGAGAGTTGCAGTACC
AAAACCTTTTATAAATCCCAATTCTCTTCATAATGCCTGCCAACTTTCCCAGGATTTTAA
TCTGGAACTAACAATGATCACCCTACTTCCAAATTTATAGCTGATAAAGTAGGTAAACTC
GAACAGAGAGATTTTGGAACTGTCAATGAAGTAAATTACTGCCCACCTACAATGTCAGGA
TTATATAAGGACACAAATTAATTCGTTTAAGGAGCAGCTTCAGCCAGTTAAGGTTGCTCA
ATTAAAAAACCAGGTACCTGCGATTATGTAGATGCCTCTGATTTCTGTCATGATGGATAT
GACGGGAAATGCAATATAGGTTTTATGATTCCAACTGATACTACTCTGATTGATGAAGAA
TCATTTAATGACTGTATGTAATGCGAAGAAGGAAAATACTGTGGTGCTAATTTCGTTAGA
AACTAAACTTGCCCAGCAGGCAGATTTTGCCTCGCAGTTACAGAAGATGAGAAACAATAC
GCTGCAGGACCAGGATAAAAGATTACGACTACAAATAACAATCAATTTACTGATCAAGCT
GATTGTACTGATGGTTACTGTCCCTCAGGTTCTAGCTCAGAATAAAGTTGCCCTGATGGT
TACAACTTGAACGTTGACCAAAATGCTCATTCCTAGTATAATTGTTAACCAAATAAACCT
GGACTTTATCAAGATAGTACTGGCACTACAACTACATGCACAGCTGGAAGCTACTGTCCT
GAAGCAGTTTAAGACACTAGTGAAATGATACCTTGCCCTCCTGGTCATTACAGTGACTCC
ACTGGTCTTATTGACAAATCATCTTGCTCAGCCTGCCCAGCTGGTAAATTCTGTCCAGAA
GAGTCTACCTCAGCTTAGCAATAAAACTGTGAAGCTGGATTCTACTGTCTTGATAGAACC
AGATAAATACATGAGAATGCCTGTCCAGGCGGTACTTACAGTTCAGCAACTACTAATGCA
TAGAGTGATATTACTTGCTTAGACTGCCCAGTTGGTTACTACTGCAAGCAGGGCTCTTCT
GCTCCAGTAGTTTGCCCAAAGAATGCCTACTGTCCTCTTAAGAGTGAACTTTACACAGAT
TGCCCAGTAGGGTACTATAGATCTTCAACTCAAGGAACTTAACTTTCAGATTGTTCTACC
TGTATGACAAACTACATATGTCCAGGTGGTACAGATCCTATTGCTTGCCCAGCTGGATAT
AATGGTTTTGATACTTCTTCAGCAACTTCTCCAGCATTTCTTACTTGCCTATCAACAACA
ACAAACTATTTCTCAGTATAAGGTACCACATAATCTGCATGTGCAAATGGCTACTATACT
CCTCTTGGAAAAGCTGCAGTATGCATTAAATGTGAGAGAGGTTATTATTGTGCAGGTGGT
GTCAGAACTGCATGTGCACAAGGAGAGAGTTGCCCAGAGGGTTCATCAGCAGCAGTAACC
TGCCCAGCCGGTTCATATTGCTCTGGTCTCCAGTTCTCTACTGTTTATAACTTGACTGTT
ACTTGCCCACCTGGTAAATACTGTCCATCAGGTTCAAGCACGCCCATTGACTCTGTAGCA
GGATACTACAATTTAGCTGGAGAGTCGTCTTCAACTGCTCATTTATGTGGAGATGGGTAC
ACTTGTCCAGGTGCTTCTACTGGTAGATTTGACACTCCATGCCCATCTAATACATTTGCT
GCTACAGGTTCATAAACTTGCACTTCATGTGATGATGGCAAATATTGCCCTATTGGGTCT
GATCAATAGTTCACCTGTCCATAAGGGTATTATTGTGATAATGCCACTCCATTCCCTGTG
AAATGCCCAAGAGGTACTTATGGAGCTAGTGTTGACCTTGCCTCTGTCGATGATTGTACT
GACTGCCCAGGAGGATACTACTGTCCCATGGAAGGTCAAGTGTCTTATTCATTAAAGTGT
GATGCTGGTTACTATTGCTCTAAAAAATCTTATACACCACAGCCAGATCCTGATGATGTT
ATTGAAAAGGAACTTGGAGGTCTATGCCCTGCTGGTTCATATTGTCCTTAAGGTTCCACT
GACCCCTTAAAATGCCCGGCTGGCACATACAATAGCTTTCCAGGAATGAGAGCTGTATCT
GATTGTATCTCATGTACACCAGGATATTATTGCATAGGTTCTAACTTAGATGAGCCCGAT
GGTCTTTGTAAAGCTGGCTATTATTGCCCATCAGGATCTTAAAAAGAAGATGAAATAGCA
ACTGATCCAGGATATTACTCTCTTGAAGGTTCATCAATTCAAATAAAATGTGAACCAGGC
ACATACACTGATTTATCTGCTTAAACTACTTGCAAGTAATGTGATGCTGGTACATACTGT
GATACATTTGGAATGGATCTCGGAGAACCATGTCCAGCTGGTTATTATTGCCCTGCAGGT
AGTGTGAAACCTATTCCATGTGCAGTTGGTACTTATAATCCAACAGCCGCTTCAAGTGGA
AGTGGTGCTTGTCAAAACTGTGATGCTGGAAAATATTGCGATGAAGAAGGTCTTACTTAT
GTGAAGGGTACTTGCTCTGCAGGATATTTCTGCAAAACAGGATCTCCCAGTGCAACTCCA
GCTATAAATCTGACTCTTTCAATTAACAGTGGCTATATTACTAAGTATGGTATATGTCCA
AGAGGTAACTATTGCCCAATCGGATCAGAAGACCCTACTCCATGCCCAATAGGCTATTAT
CTTAATGGAGAAGGTGGTAATGCTTTAAGTGACTGTGTGAAATGCCAAGCTGGATCATAT
TGCGACGCTACTGGCTTAGCTGTCCCAAAAGGAAACTGTGACCTTGGTTACTATTGTGAA
GCAGGATCAGACTCAATTCAAGAGACTGTATGTCCTGTTGGCCATTACTGTTTAGAAGGT
TCAACAAATGCTTTAATTTGTCTTTCAGGAAAATTTTAAGCTACTACTGGATAATCTACT
TGCGACGATTGTACTGCTGGTAATTTCTGTAGTTACTCATCTTCAACTGAAACTACATGT
CCAGCTGGTTCTTACTGCCCAGCAAATTCTAAGAGTGCAGATTAGTACCTTTGTCCCTCA
GGCACATTCAACGAGTTGACCGGTTCATCAGATATCGTAGATTGCTTGACATGTGAAGTT
GATAAATATTGCAAAATTCCAGGTGCATCCACATCCGATGTATCTACTGATTACGATAAC
AAACGTGGCTTAATCTTGAAAGGCTATAATAATGAAAATGGTGGAAGCAAATACTCCATT
CCTATTGATGGAAGTCTCTGTTCACAAGGATAATCTTGTAATGGTGGTGTTGAGACTCCA
TGTCCATCTGGAAAGTATTGTGGGAATCAAGGACTCTATGAGCCATCAGGGGATTGTGAA
GCAGGATATTTCTGTGATAGTGGAGCAAAGTATAGAATCTTGATTCACGATGATGGCACT
GACAACGATAAGATAAGCATTTGCAGTTAAGGAGCTTATTGTGAAGCTGGCACAATTAGT
GAATCTCTATGTCCAGTTGGTACTTTCTCAAGTGGCACTGGTCTCTAAAAAGTAGGAGAT
TGCTAGGAATGTCCAATTGGTTATATTTGTGATATTGCAGGATAAACTTTAAATGAATTA
AGCAAATGCCCTGTTGGTAAGTTTTGTAATGGTAATGTAGATGCCTTGGCCTCAACTACG
ACTTGTCCAAATGGGAAATACTGTAACTAAGATAACATTGCTCCTTAACCATGTGACAAA
GGTGAATACAATGACTTAACTGATCAATCCGTATGTTAGACATGCCCACTTGATAAGTAT
TGCCACTATGGTTAGATCAATCCAATTACTCTAGATTCTGGTTATTATCAAAATAAGACT
GGCTAAGCAGTGCCTATTCCATGCCCCGCTGCCCATTATATTGATACTGCTGATTCTAAT
AAATGTAATGTTTGTCCTATTGGTACTTATTGCGGACAATACTTGCTTTAGAGTACTTTA
ACTGATCGTTTATGTCCAAATGGGTATTATTGTGATAGAATTGGAATTATAGACTACTAA
ACACTTTTCTGTCTTCCAGGTTACTACTGCCCCTCTAACTCTGAATTGAAACTATGTACT
GCAGGTTCATATTGCAAAGGCTTTGGAAATATTGCAGTTACCGGTCCTTGTGAAGCAGGG
TACTACTGTAATGCAGGTTCTAAAGTGCCTAATCCAATCGATAATGTTTAAGGAAACGTT
TGCCCAGTTGGAGCATACTGTGTAGAAGGTTCAACTGCCCCAGTACTATGTCCAATCGGT
ACTTATAATGACAAAGTAGGAGCTTCAAGTTTAAGTTTCTGCTTATAATGTCCTGATGAA
AGATCTTGTTTGACTGAAGGTACTTATTCGCCAGGTGATGGTTGCCCGGCTGGTTACTAC
TGCGTTACAGATCCTGTCACTAAATTACTACAGCAATTTGAATGTGAAGAAGGCTATAAA
TGCCCAGCTGGAAAGTCAGTGAAACAAATTTGCCCTCCAGGCACATATCAAAATTAGAAA
GCTTAAGATACTTGCCTAGCATGCACTGCTGGCTCTTATTGCTACAATAATGGTGGACCT
ATAGTTGCTACTTAAACTTGTCCTTCAGGTTATTATTGTCCAGCCTCAACAGCCTTATAT
CAAATGTATCCTTGTGAAACTGGATCATATAACGATATCACTGGTCTTTCGGCTTCTACT
CAATGCAAGCCATGTGACTACGGAAAATATTGTAGTAAGAGAGGTCTCACAGCTCCAAAT
GGAGACTGCAGAGATGGTAGAATATGTGCAGCAGGCTCAAAAACACCTTAAGGTTCTGAA
TCATGCACAGCTAATAATTACTGTAAAGCAGGTGTTATCTACCCATGTCCAATTGGTACT
TATAATTCTCCTAGAGGTTTAAGTGATTCCACTTAATGCGTTTAATGTCCTCCAGGAAGC
ATTTGTAGCTCAACAACAACTATCACGGATTGCACAGCTGGCTATTATTGCGAAGGTAAT
GTAGCTACAATTTTAGATGCTACAATATGCCCTGTCGGCAATTATTGCCTTGCAAAATCT
TATGTTCAATTAAAATGTATGCCAGGTACTTATCAAGATGAATAAGGTAAGACATCATGC
AAGTAATGCCCAGACAACAAGTATTGCGATGAATATGGAATGTCAACTCCTAAGAATTGC
GAGGTGAATATGCAATGCCCAGCAGGTTCAATTTTACCAAAGCCTTGCTCAATAGGTTAA
TATGCAGATGCAAGTAATTAATGCGTGGCTTGTCCAGAAGGCTAATACTGCTGGCCTGAA
AAAGGAACTGATGGAAAATAAGGTGTTTGTGAAGCTGGCTACATCTGTTAATCAGGATCT
TTCAGTCCAAGGCCTTTCTACAATGTAGATACTGTTGCAAATGACCTTGTAATTTATAAC
GGTCCAGCGTTGAGAGGGTACTACTCAACTGACGGTAAAACACAAACCAAATGTGCAGTG
AAGACCTTCTAACCATCCCGTTGGTCTGATAGTTGTCTTGACTGCTATGCTGGTTCTTAT
TGTAGCAAAACTGGAATGAAGTCACTTGTTGGTTATGATTGTACCATGAGCACACTCTGT
TAGGAAGGCTCATAATATCCACTTGGTGAACTTTGTGCAGAAGGTTATACTACTGAGACT
GGTTAATCTCATTGTATGGCATGCGTTGATGGTTATTTCTCAACTGGAAGTGGCTAGTGT
TAAAAATGTCCTTCAGGATATTACTGCGATAATACTAAACTTTAAACTGGAGGAGTAGTT
TAATAAAAATGTATTGTTGGTGCTAACTGCCCTGCTGGAAGTCCATTTGAGCCTATTTGT
GCTGAAGGCAAATACTTATCCTCCACTTCATGCGTAAACTGTGATATTGGAAGATACTGT
AGAGGAGGAGTCGATACTGGTATCTGTACAGCTGGGTACTTCTGCCAAAGTGGAGAATCC
AGTCCAACTCCACCATTGCTCATGTGCTCTGCTAATAAATATTGCCCACACGGGGCTACA
AGAGAAGCGAAATGTCCAACTGGTTACTACAGACCAACTAAAGGAGCTATTTAAGTCACA
GATTGTGTGGAATGCTCAGCTGGTTATATTTGTATTAACAATCAAGTTCCTTACGAATGT
CCAAAAGGTTTCTATTGCCCATATGGTACAACAAGTGAAATCCCATGTCCCATAGGAACC
TGGTCTCAATCAACCTCTCTAATTGCAGCTAATGAGTGTTAGAATTGTCCATCTGGATAT
TTGTGCAACAAAACTAACATTACTGATTATTCAAAGTATCCATGCCCTAAGGGTAGATAT
TGCCCATCCAGAGCTCAAAGGGCTTTTAGTTGCCCAGCTGGTACTTACAGATAGACTACT
GGTGCAAGAATGGAAGCCGATTGCTCAACATGCCCACCAGGCTATTACTGTCCAGAAGGT
ACCACAAATCCAATTAGATGTAAAGACGGTATGTACTGTCCAGAAGGTGCAGAATACTTT
AGGACATGTAGAGGTGGGTACTATTGTTCAGAAGCAACAAATTACTAAGAAGAAATTTGT
CCAACTAACTATAAATGTCCAAGAGGGTCATCTACCCCACAACTTTGCGATGGCAGATTG
ATTTGCAAGGAAGGTTCAGAAATTGGGCTAGTATGTAGTGCAGGTTCATTTGTTTAAAAA
TCGGAATATGGTTTTATTGATGAATGCCTTTCTTGTCCAATTGGAAAATATTCAACTATG
AGTGATATAACTTGCAAAAATTGTACTGCGGGTCACTTATGCTATGGCGAGACAAATAGA
AAACACCCTACTGATTATCAAGTTCATCATGGTGAAATTTGTCCAAAAGGTCATTACTGT
GAAGAGGGATCTTCAATCTCTACACCTTGCCCACTTGGTTCTTATAATGCTAATTATGGA
GCTGAATCAATCAATTAATGCCTTTTATGTCCAGAGAATACATTTAACGATGAATTAGGT
CAGAGTGGTTGCAGAGCTTGTGGAGCTTATGCTAATTCTATAGAGGGAAGTTCTACTTGT
GATTGCATTGGAAACTTCAGATCTTTCTCAAGTGCCGATTCTTCTTGCAGATGCAAAGGT
GGATACGATTACATCAATCCTTTAACTGATTAGTCAGAAGGAACTCAGAGTGACGATACT
GATTGTACACCTTTAGTGTTTGATAGATGCGATGGAGAACTCTAAACAAGAGATTTATAT
GGAAGCTGTGTTGAACTAACCGACTGTTCAGCTGCATGTCCCAGTGGAAGAGGTAATCGC
TCTGAGACCACAGGTGTCTGCACATGCGAGGAGAAACAAAATGTAGATTCAACTTGTAAT
TAGAATTGCAGATCTAAGGCTGCTTCAATGACAATAAACACCACAAGTGCTTCGACAAGT
GTCATTAAGATTACTATTAATGGGAAGACTACAGAAGTAGATCTTGATAAAATAGGGGAT
TTCTATGGAAACTTTGATTGCAGTGAATCTGACTCAAACTGTACTATTAGAAGCACAGAA
ACCTCGGATGATGGATTTTAAGGAAATTATGGTTCTTCATCATTAGTGGAGTCTACTTCA
AAGAAAATACTCAGATAAATGTTTAGTGATTTCTTAGACGAGCCACAGAATGATATGGCT
TTAAGAGATCATGATGGCTAGAGATATTTGTAGACATCAGCTAACACTAATGCAATTACC
AATCCAGTTTTCTGCATTAGCATGGGCACTTCAATGCTATTCACAATTAGTGATCCCACT
CATTACCCAGTATACTTGAAAGATTCTGTGATGAATTCTAATCCATCTTTTGACTATGGA
CAATTCCTGATCTTGGAAACATCAATGAAATACAAAATTGCCAGTAATAATACGAAAGCT
TCATTATTTGCTTTTACATTCACAGATGGAGGAAGTTACTTATTTGCAGATGCAGGTGAC
TTCAATAAAGTTATGTTAGTTAAGGTAATGGAAAGTGGAGAGACCTGTTCAGATTCAGAT
AGATACATTCAACCCCTCAGTGGTGAGTCAGTCGCAAGCGTAGGAGTCTCACAAAAAGAA
GATATTATCATAAAACCTGATATTCCACTGCTAGTTGGTATTGGTGCTATACTTATTATC
TCTATTGGAACAGTCATGGTTGGTGTTGGCTATTGTTTGCATAAAGGATGGTCAATAAAG
CGTGCAATAATTGAAGGTTATCGCAGTCTCTATGGTAAAATCGATATAAACCATTCTTCC
CAAAAGACCTTCCAAAAAGACAATGATTTTGAGAATTACAGATCACACATGGGCTCAGAT
TCCGAGGAAGACGATCTCGACAACATAAATCTAGATATTCACTAAGACTTAATCGAAGCC
GGTTAGAACTACCTCAAAGTGTTCGATGAGAATAAAAACAAGAGAATCCAGGAGAAAAAT
GGCAAGAAGGGAGAGATACTTTAATTAATGAAGGAACTTGAGGATATGATTTCAGTGATT
GGATCTGACGCTATGGCCAACTAAATGCAAATTGTCAACTAAAATAGTCCAGATGACGAC
CTCGAACAACAGATACTTTTGTTACAAACAGACGAAGATGACGAGTAGGCAGAACTAAAG
AGATAGAAGTTCATGCAGTACGAGGATGAAAGAGAGAGAAAACAGAGAGAAGCTGAGGAC
ATCAAGAGATAAAAGATGATGAATGAGTGGTCAGATAGAGATAGACTGAAACTCAAGGAA
GCTCAAGACAAAATGAACAATGGATTGGAGGTTCTAAAGAAGGAATTCAACGCAGACGGC
AATAAGACTGTAAATAGAATTAAAAGTGGAAATAATGACGAAGTTGTTATAGCTGGTGGT
GATGATCTAGCTCTTGCTCTATATGATGGCGGAGATCCAAACTCAAGACACAATTAGATA
GTAAAAGCCATTGAAAACAACTAAAATCTAACTGAGGAGGAGAAAGAAAACCTTCTTCGT
AATCATTAAAAGCAGCTTATGCAAATTGATGATTTAATGGATGCAGAAAAGCGTAAATAA
AACGAAGAGATGGAACGTGCTCTCAAAGAACGTATTGATAAACGTAGAAAAGCACTTGAA
GCAAAGCATAAAAAAGAGATTCAAGGGGATGTGAAAGATTAAGAACAACTCCTCAAGGAG
GAAATTGAGAGAAATCGTAAGAATGGGCTAGCTGAGATTGATGAGGATGTGCAGAATAGA
ATGGATGAGCTCACCAATAACTTGAAAGATGGACAAGCTGCTAATTATAGACAGTGGGTT
GAGGAATTGAAACGTGAAAGAGAATTAAGAAAGCAAAAGTTCAACCAATAAATGGATGAT
GAATATCAGATTAGACTAAAGAAACTCAAGGAAGATGTTGTCAATAAATACACATAAGGA
GCCTAAGATGATAATGAACTTGAAAACCTAATGAAGCAAGCTCACCCAGGCATGGAAAGT
GCAATTGATGAACTTAAACGTCAGAAAATGTCCGAAGAGAATAAATTAAAGGACAAATTG
AAGCAAAGGAAATTAGAACTTAAGAAAAAGCAACAAGATGAGAAAGAGAGATTTGATGTA
GAAATCATGACTAAAGATCCACTACTAGAGGAAGAATTGGAATAAAAGAAAAATGCCCTT
AACAACAATAATAATGGCATGGATATTAATGATTCTCTCCTATAGCCATCTCAAATGAGT
GTAAGAGGTGTAGACAAAAATCTGTAATAAGACTTAGACAACCCCAAAGACGAAGCCTAG
ACAGCATTCGCAAAATTACTCAAAGAAATCGATACTCAAACTTAGACTTCTCACTTACTA
GAAGCATTAGGCCACGTAGATTCCAACCTAGGTCTACTTTTGAAAGACAACGAAGATGAG
CAATCCAAGAAACTGGAGGCCAGAAGGTAGCTGCTCAGACAACGCAAAATGCTTAAGCAA
TAACAAGAGCAAGAGCAGGAACGAATCAATGAAAGATTGGCTTAATTGCAATTGGAAGCA
GAAGAGAAGGACAAAATTTAAATGAATTTCGTAAAGGAAATGTTCAAGAAGCAGGATGAA
ATGCATGATCCACTCAATTAATCAGGTGCAACAAACAGAGCTGATCCTAATGCCATTCAA
CAGAAACTACTTATGTTAAACGAATTTTCATCAGATGCCTTCCTTTAAAGATTATCAAAC
CTTCTAATGAAACAATTCCTAGAGAAGGAATCTTAACTGAAACTTTTACTATAAAAGTAC
ATGGACTAAAAACTCATTGAGAAAAACAACATTAAGGAGAATTTCAAAGATTAATTTGAT
AAACTTAATAAATTGAGAGATAGTCAGCAGATCAGCGAGGGTGACTTCTAGGATGCTCTT
AAGAATCTTAGGTTGAAGGAGGAGAATATTCTTAGAGACATTGATTTGCATTTTGATAAA
GCCATGAAAGAGGAGGAATTGAAGCTGAGGGAGACACTTGAAAGAAAGCACGCTGATGAA
CAGATTGAGATTAAAAAGCGTGAAGTTGAGGACCAATTAAAATTGAAGAAGGAGCTCATG
CTTTCTGATGAATCCAATAAAAAAGAAGAGTAAAAGGAATTAGATTAATTGAAAGCCTAT
GAACACAATAAAAAGAGAGAAGTTGACAAGAAAATCAGAGGAATTGGTGTTTAGAAAACT
GAGATCATGAGATAAATCCAGAAAGATCTCGACAACAAATATGAAGATTATGAGGATTTA
CTCAGAAGAAAGAGAGATGAAGAAGCACTTCTTTAGGAACAAGCATTAAACATAAGAAAG
AAACTTCAAGACAGAAAGAAAAAGCTGAAGGAGCAGGGCGTGTAGGAGATGTCTCAAGCA
GACTAGAAGAAAATGATAGATAACTACAATTTGCAACTTTAAGCTTTGGAATCAGTGTTC
GAAGAAGAGAAAAGACGTCAATTACTCATTATGAAGAAGAAGCAGTAACAGAGAGTTGCC
AAGGTGGAGAAATTCAAGGATTTAATCGAGAAAGTGGAGGAGTAAGAACTTGATGCAATC
AAGAATGAATTGGGAACTACATTTGGAGACACATTCTTCAAACCAGGTGAAAACACTGCT
AATTTGGAAGAAATCGGCATCAAGGAAGATGACGATGAATTGCTCAAGAGACTAAAAGAA
TGGCGTGATAGAAGAAACGAATTCAAGATGGACGAGGAAGAGAAGAAACTAGCAGAGACT
GTCATTGATTTGGATTAACTCACCCTTAAGAAACTTATTCTTAAATTGGACAACCTAGAG
AGATGCCTAAGAGAATTAAGAAAGATTAAGAAATATGATACTGAAAGATTCGGACCAGAT
TACTTCTAGGGTAGTTTCAATAACTCCAAAGATGCTAGATCTCAAATTAATAACTAACCT
GCAAAGTTGCAACAATTAAAGAACAGCAATTCTGAAGAAAAACCAAAGACCATGCAACAA
CAAAGATCTCAAACAGATTTGAGTGCTAAAAATGATAAGAGTGGAAGCAAAATTAGTTTA
AGCAAAGGAAATAATTTCAATCAGTAAGTGCAGCAAGTACAAAACGTAAAGCAAGTACAA
TAAGTACAGCAAGTTAGATCTCCCTCACCTTAACCAATCCAAACTTAAAAAGCTGCACCC
TAAGTAGCCAAAGCTGATCTAGTTAAAGCTGTTAACTAAGTGAACAAAATGCAAAAAGTG
ATTAAAAAGGTAGAAAGCATTGTGGAAGAAGAGAAATAACACAATGTCGCCAAGAAGATC
GCACCTGCCTCAAAGTTTATCACTGACCCAAAGCCAATTGTGCTCTAGATGATGAATGAA
TCCATTGCATCACCTCGTACTCAAAACAGCAGAGGAGGATTTATAAGTGGTAGAAATAGA
TCACCAGCAGTTGCCGCTGTCGATGATAAAGTCACAACAGAGAGAAGTGAAGGCAAAAAG
ATTGATTATTCATAATTCAAGAAATTCGTCAAGAAGAGATGA


>Contig761.1.g41(protein)
MIYYLKAIILVGNSYKCPSDFVKTACSPGEYSPMGSIVCTTCPSGYYCPTTSDPPQICSV
GTYPAANQLSCTTCPAGKYCGSPLSTSPVTCTAPTFYQSLTGQTECLTCPAGSSCTASAT
AQCSSTNGYYSVLGTGTCSQSQKGYFTPERQMNTASCPTNTYTSAVGQYSCSQCDSGFSC
SDQIGTKTACATGTFSPLGVTTCQSPTSPYIYDTSTSAINKPCTEGYYSTSNACVQCAAG
KICSDTATVSNCPVGQYSTIGKGYCMPCKSFYGCNAPASPAICTTSQYLNPITSTCTTCP
LNQVCSVSSQKVAFPRFCSPGYYRSSATACTICPEGSYCPDGKTTSATACATKYISGTGY
TACIKCPAGYDCNGKTYLSLITKCAAGYYSLEGDAICSKCTTGQICPETNTVYENCIAGT
YITSTGSSASKCTLTDVNYKSTGLTSSPSACTKTQFAKYGQTSCTTCPTNEPCSIDRKGF
LSDCDPGFSFDSATNTCKQCTAGKECLDSTATTCPKGTLEKAVESFQCLECPTPMICAIS
GSSVVNNYCYGKESGVTVVVEFTKAVRLPYYDYQYCIDCNSVDLNQKVCTFATNYFTSQV
GANLTCPSTRSKSYDNTINGVEFTDYRYWDKTNYDYPFCDIKSSTTIPGFDLDPPESCST
KTFYKSQFSSQCLPTFPGFQSGTNNDHPTSKFIADKVGKLEQRDFGTVNEVNYCPPTMSG
LYKDTNQFVQGAASASQGCSIKKPGTCDYVDASDFCHDGYDGKCNIGFMIPTDTTLIDEE
SFNDCMQCEEGKYCGANFVRNQTCPAGRFCLAVTEDEKQYAAGPGQKITTTNNNQFTDQA
DCTDGYCPSGSSSEQSCPDGYNLNVDQNAHSQYNCQPNKPGLYQDSTGTTTTCTAGSYCP
EAVQDTSEMIPCPPGHYSDSTGLIDKSSCSACPAGKFCPEESTSAQQQNCEAGFYCLDRT
RQIHENACPGGTYSSATTNAQSDITCLDCPVGYYCKQGSSAPVVCPKNAYCPLKSELYTD
CPVGYYRSSTQGTQLSDCSTCMTNYICPGGTDPIACPAGYNGFDTSSATSPAFLTCLSTT
TNYFSVQGTTQSACANGYYTPLGKAAVCIKCERGYYCAGGVRTACAQGESCPEGSSAAVT
CPAGSYCSGLQFSTVYNLTVTCPPGKYCPSGSSTPIDSVAGYYNLAGESSSTAHLCGDGY
TCPGASTGRFDTPCPSNTFAATGSQTCTSCDDGKYCPIGSDQQFTCPQGYYCDNATPFPV
KCPRGTYGASVDLASVDDCTDCPGGYYCPMEGQVSYSLKCDAGYYCSKKSYTPQPDPDDV
IEKELGGLCPAGSYCPQGSTDPLKCPAGTYNSFPGMRAVSDCISCTPGYYCIGSNLDEPD
GLCKAGYYCPSGSQKEDEIATDPGYYSLEGSSIQIKCEPGTYTDLSAQTTCKQCDAGTYC
DTFGMDLGEPCPAGYYCPAGSVKPIPCAVGTYNPTAASSGSGACQNCDAGKYCDEEGLTY
VKGTCSAGYFCKTGSPSATPAINLTLSINSGYITKYGICPRGNYCPIGSEDPTPCPIGYY
LNGEGGNALSDCVKCQAGSYCDATGLAVPKGNCDLGYYCEAGSDSIQETVCPVGHYCLEG
STNALICLSGKFQATTGQSTCDDCTAGNFCSYSSSTETTCPAGSYCPANSKSADQYLCPS
GTFNELTGSSDIVDCLTCEVDKYCKIPGASTSDVSTDYDNKRGLILKGYNNENGGSKYSI
PIDGSLCSQGQSCNGGVETPCPSGKYCGNQGLYEPSGDCEAGYFCDSGAKYRILIHDDGT
DNDKISICSQGAYCEAGTISESLCPVGTFSSGTGLQKVGDCQECPIGYICDIAGQTLNEL
SKCPVGKFCNGNVDALASTTTCPNGKYCNQDNIAPQPCDKGEYNDLTDQSVCQTCPLDKY
CHYGQINPITLDSGYYQNKTGQAVPIPCPAAHYIDTADSNKCNVCPIGTYCGQYLLQSTL
TDRLCPNGYYCDRIGIIDYQTLFCLPGYYCPSNSELKLCTAGSYCKGFGNIAVTGPCEAG
YYCNAGSKVPNPIDNVQGNVCPVGAYCVEGSTAPVLCPIGTYNDKVGASSLSFCLQCPDE
RSCLTEGTYSPGDGCPAGYYCVTDPVTKLLQQFECEEGYKCPAGKSVKQICPPGTYQNQK
AQDTCLACTAGSYCYNNGGPIVATQTCPSGYYCPASTALYQMYPCETGSYNDITGLSAST
QCKPCDYGKYCSKRGLTAPNGDCRDGRICAAGSKTPQGSESCTANNYCKAGVIYPCPIGT
YNSPRGLSDSTQCVQCPPGSICSSTTTITDCTAGYYCEGNVATILDATICPVGNYCLAKS
YVQLKCMPGTYQDEQGKTSCKQCPDNKYCDEYGMSTPKNCEVNMQCPAGSILPKPCSIGQ
YADASNQCVACPEGQYCWPEKGTDGKQGVCEAGYICQSGSFSPRPFYNVDTVANDLVIYN
GPALRGYYSTDGKTQTKCAVKTFQPSRWSDSCLDCYAGSYCSKTGMKSLVGYDCTMSTLC
QEGSQYPLGELCAEGYTTETGQSHCMACVDGYFSTGSGQCQKCPSGYYCDNTKLQTGGVV
QQKCIVGANCPAGSPFEPICAEGKYLSSTSCVNCDIGRYCRGGVDTGICTAGYFCQSGES
SPTPPLLMCSANKYCPHGATREAKCPTGYYRPTKGAIQVTDCVECSAGYICINNQVPYEC
PKGFYCPYGTTSEIPCPIGTWSQSTSLIAANECQNCPSGYLCNKTNITDYSKYPCPKGRY
CPSRAQRAFSCPAGTYRQTTGARMEADCSTCPPGYYCPEGTTNPIRCKDGMYCPEGAEYF
RTCRGGYYCSEATNYQEEICPTNYKCPRGSSTPQLCDGRLICKEGSEIGLVCSAGSFVQK
SEYGFIDECLSCPIGKYSTMSDITCKNCTAGHLCYGETNRKHPTDYQVHHGEICPKGHYC
EEGSSISTPCPLGSYNANYGAESINQCLLCPENTFNDELGQSGCRACGAYANSIEGSSTC
DCIGNFRSFSSADSSCRCKGGYDYINPLTDQSEGTQSDDTDCTPLVFDRCDGELQTRDLY
GSCVELTDCSAACPSGRGNRSETTGVCTCEEKQNVDSTCNQNCRSKAASMTINTTSASTS
VIKITINGKTTEVDLDKIGDFYGNFDCSESDSNCTIRSTETSDDGFQGNYGSSSLVESTS
KKILRQMFSDFLDEPQNDMALRDHDGQRYLQTSANTNAITNPVFCISMGTSMLFTISDPT
HYPVYLKDSVMNSNPSFDYGQFLILETSMKYKIASNNTKASLFAFTFTDGGSYLFADAGD
FNKVMLVKVMESGETCSDSDRYIQPLSGESVASVGVSQKEDIIIKPDIPLLVGIGAILII
SIGTVMVGVGYCLHKGWSIKRAIIEGYRSLYGKIDINHSSQKTFQKDNDFENYRSHMGSD
SEEDDLDNINLDIHQDLIEAGQNYLKVFDENKNKRIQEKNGKKGEILQLMKELEDMISVI
GSDAMANQMQIVNQNSPDDDLEQQILLLQTDEDDEQAELKRQKFMQYEDERERKQREAED
IKRQKMMNEWSDRDRLKLKEAQDKMNNGLEVLKKEFNADGNKTVNRIKSGNNDEVVIAGG
DDLALALYDGGDPNSRHNQIVKAIENNQNLTEEEKENLLRNHQKQLMQIDDLMDAEKRKQ
NEEMERALKERIDKRRKALEAKHKKEIQGDVKDQEQLLKEEIERNRKNGLAEIDEDVQNR
MDELTNNLKDGQAANYRQWVEELKRERELRKQKFNQQMDDEYQIRLKKLKEDVVNKYTQG
AQDDNELENLMKQAHPGMESAIDELKRQKMSEENKLKDKLKQRKLELKKKQQDEKERFDV
EIMTKDPLLEEELEQKKNALNNNNNGMDINDSLLQPSQMSVRGVDKNLQQDLDNPKDEAQ
TAFAKLLKEIDTQTQTSHLLEALGHVDSNLGLLLKDNEDEQSKKLEARRQLLRQRKMLKQ
QQEQEQERINERLAQLQLEAEEKDKIQMNFVKEMFKKQDEMHDPLNQSGATNRADPNAIQ
QKLLMLNEFSSDAFLQRLSNLLMKQFLEKESQLKLLLQKYMDQKLIEKNNIKENFKDQFD
KLNKLRDSQQISEGDFQDALKNLRLKEENILRDIDLHFDKAMKEEELKLRETLERKHADE
QIEIKKREVEDQLKLKKELMLSDESNKKEEQKELDQLKAYEHNKKREVDKKIRGIGVQKT
EIMRQIQKDLDNKYEDYEDLLRRKRDEEALLQEQALNIRKKLQDRKKKLKEQGVQEMSQA
DQKKMIDNYNLQLQALESVFEEEKRRQLLIMKKKQQQRVAKVEKFKDLIEKVEEQELDAI
KNELGTTFGDTFFKPGENTANLEEIGIKEDDDELLKRLKEWRDRRNEFKMDEEEKKLAET
VIDLDQLTLKKLILKLDNLERCLRELRKIKKYDTERFGPDYFQGSFNNSKDARSQINNQP
AKLQQLKNSNSEEKPKTMQQQRSQTDLSAKNDKSGSKISLSKGNNFNQQVQQVQNVKQVQ
QVQQVRSPSPQPIQTQKAAPQVAKADLVKAVNQVNKMQKVIKKVESIVEEEKQHNVAKKI
APASKFITDPKPIVLQMMNESIASPRTQNSRGGFISGRNRSPAVAAVDDKVTTERSEGKK
IDYSQFKKFVKKR