Identifiers and Description

Gene Model Identifier

Contig7554.0.g32

Standard Name

None

Aliases

Contig7554_0_g32

Description

Proteasome/cyclosome repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003396109.997093137033517e-262Proteasome/cyclosome repeat fa
mily protein
SGDYHR027C9.002272056803922e-129RPN1 SGDID:S000001069, Chr VII
I from 164711-161730, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7554.0.g32(coding)
ATGTCAGACAAGCAATAATCAAAGCCAGCTGAAAACAATCCAGCCAAAGATAACTAAGAA
GCCAACGAAAAGAAAGCTGCTAAGGACAAGAAAGACGCTCTACTCAAGGAAGAAGTATTG
AGTGAGGAAGATCTTGCATTGAAAGAGAAAGTGGAGATTTGTGTTGAAAGACTTTCAGAT
CACGATGAAGCTCAACGCAAGCATGCTCTCTAGCAATTAAAACAAGAAATTTCAGGGTCT
ACTGCCACTATGACATCAGTCCCCAAGCCCTTGAAGTTCTTGACACCCCTCTACGCAAAG
ATCAGGGAGGCTTATCTCAGTTAACCAAATTCATAATTCAAGACTGAGCTTGCTGATTTG
GTTTCAGTGGTAGCCATGGTAGCATCTCCAGAGGGTTCATTTGAAAGCATTAAATTTTGC
CTCGAGGGAACTAAGACCAACTTGGTTGAATGGGGTCACGAATACCTGAGATCATTGGCT
GGTGAAATCGGAAACGAGTACAATAAGAGAATTGAAGCACAGCAAGAGACCAGGGATCTT
ATGGAACTCGTAGAGGTTATCATTCCCTACTTTATGAAGAACCATGAAGAGCCAGAAGCT
GTTGATTTGTTGATGGAGGTGGAATCATTGGATAAATTAGTTAAATTTACTAGTGATTCA
AACTACGAAAGAGTCTGCCTTTATCTCTTGAGTTGCGCTCAATACGCAGCTGACCCAGAA
GAAATGATGAATGCCTACAAAACTGCTTTCAAGGTTTACATTAAAGAAAAGAAATATCCT
CAAGCATTAAGAGTAGCTTAGAAAGTGAATGACATGAACATGATTCGTGAAGTAATGGAG
ACTGCTTAAGATCCAGTGACTCAAAAGCAACTCGCTTTCATGCTAGGAAGACAAAGAAAC
CCATTTGAAGCCTCTAATGAAGAACTACAAAGAATTATCTCTAATGAGAAGTTAAGTGAG
CATTTCAAGGCACTAGCCAGAGATTTGGATGTACTAGAGCCCAAGCACCCAGATCACATC
TTCAAGACTCATCTCGAAGAGAGAAAGAACAATGTTGCTCAACACATTGATAGTGCAAAG
TAGAACTTAGCTGCCACTTATGTGAATGCATTCGTAAATGCTGGTTACGGCAAGGACTTA
CTTATGACTCCCAATGAATCTAAGGATAACGCATGGATTTACAAGAACAAAGAAGATGGT
ATGCAAGCAGCAGCTGCCTCACTAGGAATGGTATTACTGTGGGATATTGATGAGGGTCTC
TCTTAAATTGATAAATACATGGAAGCCAGTGATGACTTTATTGTTGCTGGTGCTTATCTT
GCCATTGGTATTGTCAACTCAGGCATCAAGAATGATGTTGATCCAGTTTTCGCTATCTTA
ATTGAAAAGTTAGAGAGTCCTAAGCAAATTCATAAAATAGGTGCTCTTATGGGTCTATCA
TTAACTTATGCTGGTTCTGCAAGAGCTGACTTATTAGAAGCAATTTCACCAATCGTATTA
GATTCATCAAACTCTATTGAACTTCAAGCAGTAGCTGCACTTGCCATAGGTTTGATTTAT
ACAGGCACTTGTGATGAAGACGCTGCTCAATCCATTCTGCAAACACTTATGGAGAAAGAA
GAGAAAGATCTTGAAAGTCCATTCATGAGAATCTTTGCACTAGGATTAGGATTATTGTTC
TTAGGTCAACAAGACTAAGCTGATGCTATTTTGACAGTATCTTCAACTATTTCAAACAAA
TAATTTGCTGATTTCCTCAGTTTAGTAGTTGAGACCTGTGCTTATGCTGGTTCAGGCAAT
GTCTTGAGAATCCAGAAATTGCTTCATTTATGTGCTGAACACAAAAAGGAAGAGAAAGAA
GCTCAACATTAAATCGCAGCTGTGATTGGAATCGCTTTGGTTGCCTTTGGTGAAGATATC
GGCCAGGAAATGTGTTTGAGAACCATGAACCATTTACTTCAGTACGGAGAACCAATCATC
AAGAGAACCGTACCACTGGCAATTGGTTTGTTGAGAGTATCGAACCCAGACGTCAACAGC
ATGGATTTGCTAACAAAACTATCTTATGATACTGATGTAAACGTGTCCATGTCCGCAATC
TTCGGCCTTGGTTTGATTGGTGCAGGCACTAATAATTCCAGACTTGCTGGTAACTTGAGG
TACTTGGCTGCCTACTACGCTAACTCACCAGATCAATTGTTTGTTGTGAGAATTGCACAG
GGATTGGTACATTTAGGCAAGGGATTAATGGGGCTTAACCCACTCCACTCAGAGAAGTTC
TTGTTCAGTAATGTATCATTAGCTGGTCTAGTTACTGTATTATATGCTGCAAGTGACATG
AAAACTTTCTTCAATGGCAAATATCACTTCTTCCTCTACTACTTAGTATTGTCAATCTAC
CCAAGAATGATGATTACTTTGAATGAAAGCTTGGAACCAATTCAAACATCAGTGCGTGTG
GGCACAGCTGTCGATACTGTTGGAGCTGCAGGTAGACCAAAGACCATCACTGGATTCTAG
ACACATGATACTCCAGTATTGATTGGACACGGCGAGAGAGCCGAGTTGGCAAGCGAGGAA
TTCCTCAGTGAGACACCTTTCATGGAAAATTTCGTTATTCTCAAGAAGAATCCAGAGTAC
ATTCATGAGTCTGATAAAGCAAAGCCAGCTGCTGCAAAGAAATGA


>Contig7554.0.g32(protein)
MSDKQQSKPAENNPAKDNQEANEKKAAKDKKDALLKEEVLSEEDLALKEKVEICVERLSD
HDEAQRKHALQQLKQEISGSTATMTSVPKPLKFLTPLYAKIREAYLSQPNSQFKTELADL
VSVVAMVASPEGSFESIKFCLEGTKTNLVEWGHEYLRSLAGEIGNEYNKRIEAQQETRDL
MELVEVIIPYFMKNHEEPEAVDLLMEVESLDKLVKFTSDSNYERVCLYLLSCAQYAADPE
EMMNAYKTAFKVYIKEKKYPQALRVAQKVNDMNMIREVMETAQDPVTQKQLAFMLGRQRN
PFEASNEELQRIISNEKLSEHFKALARDLDVLEPKHPDHIFKTHLEERKNNVAQHIDSAK
QNLAATYVNAFVNAGYGKDLLMTPNESKDNAWIYKNKEDGMQAAAASLGMVLLWDIDEGL
SQIDKYMEASDDFIVAGAYLAIGIVNSGIKNDVDPVFAILIEKLESPKQIHKIGALMGLS
LTYAGSARADLLEAISPIVLDSSNSIELQAVAALAIGLIYTGTCDEDAAQSILQTLMEKE
EKDLESPFMRIFALGLGLLFLGQQDQADAILTVSSTISNKQFADFLSLVVETCAYAGSGN
VLRIQKLLHLCAEHKKEEKEAQHQIAAVIGIALVAFGEDIGQEMCLRTMNHLLQYGEPII
KRTVPLAIGLLRVSNPDVNSMDLLTKLSYDTDVNVSMSAIFGLGLIGAGTNNSRLAGNLR
YLAAYYANSPDQLFVVRIAQGLVHLGKGLMGLNPLHSEKFLFSNVSLAGLVTVLYAASDM
KTFFNGKYHFFLYYLVLSIYPRMMITLNESLEPIQTSVRVGTAVDTVGAAGRPKTITGFQ
THDTPVLIGHGERAELASEEFLSETPFMENFVILKKNPEYIHESDKAKPAAAKK