Identifiers and Description

Gene Model Identifier

Contig746.1.g14

Standard Name

None

Aliases

Contig746_1_g14

Description

PCI domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003884402.000555387360374e-52PCI domain containing protein
SGDYDR427W2.000364041471746e-45RPN9 SGDID:S000002835, Chr IV
from 1322205-1323386, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig746.1.g14(coding)
ATGATCCATTAAGCTTTGAATGAGAATTAGCTTGCCCTCGAGAGTGAGCTGACTACCAAT
CGGCTTCTGGTAAATCATAAGGTCGTGATAAGGTCAAGTTTGAGAAGGTTTGACTTAGAG
ACAGGCAAAATGAAAGAAACTGTGATAGATTTCAAGAGATTCAGAGCAAAGCCTTTAATA
TAAATTAACTAATTTTATAAATATAAGTTATTAACACAAACTTGCCTCGACACTCAAGCC
AGAAAGTTCCCAAACCTTCAACAGAGCATCGATCTGATTACCCAAACCTACAAAGAGAAA
TTATGGCATTAGCTAACTGAGGCTTTGTTCTCTTACACAAATGATAAAGCTTTTGATGAA
GGGCAAGATCTTATCGAACTTTACAATTGCTTGATAAAGGACTTAACCTAGAGAGTTAAC
CCACTCAAGTATGCCTAGATAACTATTACTGTATCAAGATAATTCACTGATCTTGAGCAA
GCCATTGAATTCTTGGATGCTGCCAAGCAGAGATTGGCTGGAAAGTAAGATGCAGTATTC
TTACTAAGTATTGGCAAAGCTGAGAAGAAACTCTAACTTGGATAGCACCACGACTGCTTC
GAGATCCTAAACTAAGTGAAAAAGGAACTTGAGGCTCTTTCAGACGTGGATCCAGTTGTT
TATGCAAATCTTAGCAAAACTTATGCCTTGTACTACAGAAGAAAGGATGATCATGAAAAT
TTCTATAAGAGCAGTCTTTAATACCTCGCATACACTCCAGCATCTGAACTAACTCAAACT
GAGAAGAAAGACTGGTCAATTAAGATGGGCATGTCAGTTCTCTTAGGCAAGAATATCTAT
AACATCAGTGAATTGCTTGATAAGGAGATTCTTCACTCATTAGTTGGCTCAGATTTCGAA
TGGCTTTATGAGTTGTTGAACACTCTTGGTAGAGGTTAGATTCAAGAATTTGGAAATGCA
ATCAATAAGCATTCAGAGTACATCTCAAGATTCGGAGCAATTAGACAAGAATTGAATAAT
CTAGAGTAAAAAGTCAAAATTATTGCATTCCTGGAACTGTTATTCGCTGTTGATAAAGAT
GAAAGAAGCATTAGCTTCGAAAGAATTTCAAGAGATTGCCACATTGGCCACAATGATGTT
GAGCTCTTACTCATGAAAGCAATGAGCTTAGAACTCATTAAGGGGCAGATCGATGAGGTT
GATTAAGTGGTACATGTTAACTGGATTCTTCCAAGATACTTGAGCAAGAGTCATCTCGAG
ATTATGGTTAGAAAGATTGGTTAATGGGAAGGAAAGATGGACGAGATCATTAAGCAAGTT
GAAGGTTAATCAGAGGAGCTTCTCTTACACTGA


>Contig746.1.g14(protein)
MIHQALNENQLALESELTTNRLLVNHKVVIRSSLRRFDLETGKMKETVIDFKRFRAKPLI
QINQFYKYKLLTQTCLDTQARKFPNLQQSIDLITQTYKEKLWHQLTEALFSYTNDKAFDE
GQDLIELYNCLIKDLTQRVNPLKYAQITITVSRQFTDLEQAIEFLDAAKQRLAGKQDAVF
LLSIGKAEKKLQLGQHHDCFEILNQVKKELEALSDVDPVVYANLSKTYALYYRRKDDHEN
FYKSSLQYLAYTPASELTQTEKKDWSIKMGMSVLLGKNIYNISELLDKEILHSLVGSDFE
WLYELLNTLGRGQIQEFGNAINKHSEYISRFGAIRQELNNLEQKVKIIAFLELLFAVDKD
ERSISFERISRDCHIGHNDVELLLMKAMSLELIKGQIDEVDQVVHVNWILPRYLSKSHLE
IMVRKIGQWEGKMDEIIKQVEGQSEELLLH