Identifiers and Description

Gene Model Identifier

Contig7446.0.g25

Standard Name

None

Aliases

Contig7446_0_g25

Description

Ion channel regulatory protein UNC-93

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam05978 ) Ion channel regulatory protein UNC-93
  • ( pfam07690 ) Major Facilitator Superfamily
  • ( pfam00083 ) Sugar (and other) transporter

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004713901.000137892321693e-31Major Facilitator Superfamily
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7446.0.g25(coding)
ATGTCTAAATCTACTCCAATGGGAACATCCTCTAAATACTAAAATTTAGACCGTATAACT
ATAATATCACTGGGATTCTTTTTCCTATTTGTGGCATTCAACTCAGCGGCAAATCTTTCA
GCTTAAATCATGAATAATGATGGCTTTGAGGGACTTGGATTTTATACAATGGCTATGCTT
TATTTGATATTCGCATTTTGCAGTTTCCTATCTGCAGCCATCGTAAACAAAATTGGCACT
AAGGTATCTCTAGTAACAGGTGGTCTCTGCTACTTTTTCTGGGTGTTCTGCTTCCTAGCA
CCAGCCTTTAAAAACGAGAATCCCCACTCAACCAGCTTTATCTTCAATAAAAACTTTATC
ACCTTTATTTCCTTGTTTTCAGCTGCAATCAATGGGTTTGGTGCTGGTATACTGTGGGTG
GCACAGGGCTAGTACCTCTCTGACTGTGCTTCTGATGCGAACAAAGGCTTCTTTTTCAGC
TATTTCTGGGCGTTCTTTATGAGTTCATAGATTCTTGGAAATCTTACAGCTGCTCTCATA
TTGGGTAACCTACCTTAAAGCACCTACTACATCATCATTTTCAAGGAAGATATCATATTG
ACTTTTCAGATGCTAGTCTCAAGAAGAATGATGTTTGTGTTGCCTTTGATTACTTGGAGT
GCAGTCTCCCAATCAATCTACAGTGGATGTTTCGTACCAATGATGAACACCACAATGGCC
GACCAATACCCAGATTGGGACTCAAACAAGAAACTGGAGTATTCCCTCCTAGCTATGATT
CCTCTGGGTTTAGGATCAGTCATTGGAGGACTCATTCAAGGTTAAGTAGCTGATAAGTTC
GGGTAGAGACTAGGAGTCATCTATATTATGATTGTGAGTGCCTGCGCTTTCGCTGTGGTG
TTTGCATTCGTGGGCACTTGGAAGTTTGGAGTGCTTACTTTCTTTATGACTTTCATTTGG
GGCATCCAAGATAGTGGAATGAATAACTATATGAGTTGCACTTTGGGCTTCCAATTTGAT
TCTAAGATTATCCCCTTCAGTATCTTGAAATTCGTGTAATCACTTTTTACTTTTATCTTT
TTGGTTGTGGAATCACTGTTAACATTCTAAGTTGACTATATAATCTATCTTATTGTGATG
GCATGTGTTTGCTTCGCATCATTAACAGTGATGCTGTTCTTCCCCTATAAATCAGTAGAG
AAACCTGGCTTGGATAGCTCTGAAAGAATCAATTAGAAGAATAAAGATTCAGCTTTAACT
GATGAAGAGTGA


>Contig7446.0.g25(protein)
MSKSTPMGTSSKYQNLDRITIISLGFFFLFVAFNSAANLSAQIMNNDGFEGLGFYTMAML
YLIFAFCSFLSAAIVNKIGTKVSLVTGGLCYFFWVFCFLAPAFKNENPHSTSFIFNKNFI
TFISLFSAAINGFGAGILWVAQGQYLSDCASDANKGFFFSYFWAFFMSSQILGNLTAALI
LGNLPQSTYYIIIFKEDIILTFQMLVSRRMMFVLPLITWSAVSQSIYSGCFVPMMNTTMA
DQYPDWDSNKKLEYSLLAMIPLGLGSVIGGLIQGQVADKFGQRLGVIYIMIVSACAFAVV
FAFVGTWKFGVLTFFMTFIWGIQDSGMNNYMSCTLGFQFDSKIIPFSILKFVQSLFTFIF
LVVESLLTFQVDYIIYLIVMACVCFASLTVMLFFPYKSVEKPGLDSSERINQKNKDSALT
DEE