Identifiers and Description

Gene Model Identifier

Contig7426.0.g14

Standard Name

None

Aliases

Contig7426_0_g14

Description

Tctex-1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007820603.999970367130025e-21Tctex-1 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7426.0.g14(coding)
ATGGACGATTTACAAGGAAACGAAGATGATAATGGATTCCCAAATGAAGAAGTAGAAAAA
TGTGTTTATGACGCAGTAGAGCAAGTTCTTGCAAATGCTTAATGGGATGAGAAGTAGGTA
CCTTAATGGATAAATGATATTTGCGAAAAGTCAATGAAGCAACTAGTCGAGCTCAATAGA
CCTTATAAGTTTATGATTACATGCATGCTAATGCAAAAGACTTAGCAATCTGGAGCGCAG
ACTGTGCTTTCTTGCTACTGGGAGAATAATACAGACAGTTACTATCAAACAATATACCCA
CCACAGAGAGCCAAGGATAGTGCTGCCAAAACTATTTAATGTATAGCTACAGTGTTTGGC
GTCAGGTTTTGA


>Contig7426.0.g14(protein)
MDDLQGNEDDNGFPNEEVEKCVYDAVEQVLANAQWDEKQVPQWINDICEKSMKQLVELNR
PYKFMITCMLMQKTQQSGAQTVLSCYWENNTDSYYQTIYPPQRAKDSAAKTIQCIATVFG
VRF