Identifiers and Description

Gene Model Identifier

Contig716.0.g25

Standard Name

None

Aliases

Contig716_0_g25

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006705904.000521932330652e-52Ubiquitin-conjugating enzyme f
amily protein
SGDYGL087C3.0006824396935516e-51MMS2 SGDID:S000003055, Chr VII
from 346808-346406,34690...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig716.0.g25(coding)
ATGGAATCAGTTCCCAGAACATTCAGACTTTACGAAGAGCTCGAAAAGGGAGAGAAAGGT
CAGCTCGGTGATCAAAGCGTTTCCTATGGTCTTGCAAGAGGCGAGGATGTGACATTCACT
GACTGGAACGGAACCATCATTGGGCCAGCAAATACCAACTACGACAATCGTATTTATTTC
TTGACCATCAAGTGCGGATAAAACTACCCAAATCAAGCCCCAGAAGTCCACTTCATGTCA
AAGATTAACATGCCATGCGTGAACTAATCAACAGGAAAGGTTGAGCCAACCAAGTTCGGA
GTATTCGCACAATGGAATAGTTCATACTCTATGGAGAAAATTTTAATCGGACTCAAGAAT
GAGATGATCCTTCACAAAAAACTTCAACAACCAGCTGATGGCGATATGTTCTGA


>Contig716.0.g25(protein)
MESVPRTFRLYEELEKGEKGQLGDQSVSYGLARGEDVTFTDWNGTIIGPANTNYDNRIYF
LTIKCGQNYPNQAPEVHFMSKINMPCVNQSTGKVEPTKFGVFAQWNSSYSMEKILIGLKN
EMILHKKLQQPADGDMF