Identifiers and Description

Gene Model Identifier

Contig7022.0.g36

Standard Name

None

Aliases

Contig7022_0_g36

Description

Calponin homology (CH) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00307 ) Calponin homology (CH) domain
  • ( pfam11488 ) Transcriptional regulatory protein LGE1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001337009.997441244797434e-45hypothetical protein
SGDYER016W6.0018235484001396e-36BIM1 SGDID:S000000818, Chr V f
rom 188277-189311, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7022.0.g36(coding)
ATGAGTGGAGACACAATTGGCATCATGGATCCAGCTTTCTTTGTTAGCAAGTCAGAAATC
CTTAACTGGGTTAATGACCTTCTAAAGTTGAATGTGCAAAAGATTGAGTAGTGTGCTACA
GGAGCAGTATATTGCTAAATCATTGATGCCATTTACCCTGGTTCAGTGCAAATGTCAAAA
GTCAACTGGTAAGCAAAGCATGACTACGAGTTTGCTTACAACTACAAAGTACTTCAAGTT
GCTCTCTAAAAGAGCGGCATTTCTCGCTACATTGATCCAACTAAGTTGATGAAAGCAAAG
TACCAAGATAACCTTGAGATGATGCAGTGGATCAAGAGATACTATGACATCAATTCTAAG
GGCGAAGGTTATGATGCCGTATCTCGCAGAAAAGGAGCTGACCTTTATTTGATTGGAGAA
CCAAACGGAAAGTCAAACCATGCTCAACCAAGACCCATGACATAACCAGCTGCTCATTCA
ATGAACACTCATCAAGCACCAGCTTAAAAGAAGATTGTATCTGTGACTGCAAATGTTCCT
TTCGGAAATGTGACAAACAAAGTAGCCCATTCCCTTGTGAATTCAGTAAACAACTCAGCT
CAATCAATTAAGCAAAGTGGTGTAAGTTAGGCTTCCTTTGATCTTCAGCAGCAGCAGCTC
GAACACCTCCAGAAAGACTGCTCCACTAAAGATGACGAGATTCTCTAACTACAAGATAAG
ATTAGGATGCTTGAGATGAGGTCTCAAGAAGTCACTTTAGAGAAGGATATGTACTTCAAC
ACCCTCAGCTGTTTGGATGAATTCGTGTCCCAGTCTCTCTCACAGCAAGATGTCCAAGCA
AACCAGGTTGCTCAACAATGCCTAAGATAAGTGCAGGAGATCATGATGATGGAAAACTCT
AATCCATCTATGGGGGCTGATGTAGCCAGAAGCAGAATGCAGCAATCCTTTGAATTGAAC
TAGTAGGAATTCCAGTCACACAGTGATGATAACAATCATCAAGAAGTTAATCATGCTAAC
CCTAGTGGTGTTTCTGCAACTCAAGATGTAAACATGGTGGAATATTTTTGA


>Contig7022.0.g36(protein)
MSGDTIGIMDPAFFVSKSEILNWVNDLLKLNVQKIEQCATGAVYCQIIDAIYPGSVQMSK
VNWQAKHDYEFAYNYKVLQVALQKSGISRYIDPTKLMKAKYQDNLEMMQWIKRYYDINSK
GEGYDAVSRRKGADLYLIGEPNGKSNHAQPRPMTQPAAHSMNTHQAPAQKKIVSVTANVP
FGNVTNKVAHSLVNSVNNSAQSIKQSGVSQASFDLQQQQLEHLQKDCSTKDDEILQLQDK
IRMLEMRSQEVTLEKDMYFNTLSCLDEFVSQSLSQQDVQANQVAQQCLRQVQEIMMMENS
NPSMGADVARSRMQQSFELNQQEFQSHSDDNNHQEVNHANPSGVSATQDVNMVEYF