Identifiers and Description

Gene Model Identifier

Contig6878.0.g46

Standard Name

None

Aliases

Contig6878_0_g46

Description

Cyclic nucleotide-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00027 ) Cyclic nucleotide-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003041901.9994920269952867e-34cyclic nucleotide-binding doma
in containing p...
SGDYIL033C0.000000000004997916451710233BCY1 SGDID:S000001295, Chr IX
from 291669-290419, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6878.0.g46(coding)
ATGTATAATTTAGTCAAATCTGTGCTGGCAATGAACAATGCCACGCAAGAACAAATCTAA
TAATCTCGCATGCTACAGCAAATTTTGTCAATTTTAAAGAGGCCTAGTGAAACTAGAAAA
GACAATGAGATCAAACAGCTAATTCCATATTTGAAATAAATCAAGTTTTTCTAAGAAAGA
TAGGAAATTATGAAGGAAAGCGATTTTTTGTTTTTATGTGAGAGAGCCACCTATGAACAT
TACAATCCACATAGAGTCATATTTAATTATGGTGACTATGGTGAAAAGTTTTACATTATA
TTGGAGGGACAAGTGAGCGTTTTGTTACCAAGAAAAAGAGAAAGAACTTCTTAAAATGAA
AATGATTCACATGAAGCAAACTAAAATTTTGATTAGCCTTAGCTACCAAATTCTCCATTA
AGAAGTCCAGCAAAGACAAATGTAATAGATCGTTTAAGAAATGCAACTTCCAGATTAATT
CAAGATGTAAAGCAAAGCAACTCCTTTTTTGTGGAAGTAGGACAAATTAAATCAGGTCAA
GGATTTGGTGAACTAGCATTAATCTCAAATAAGCTTAGATCAGCAACTATTAAAGCTTCA
CTTGACACGCATTTATTGGTGCTTCAAAGAAAAGATTTTGAGAAAGTGCTTTAAAGGCAG
GAAGAAGCAAACATTTAGAAAACTGTAGATTTCTTGAAAAATATGCCTCAGTTTAAGAAT
TGGACTAAAAACAGTCTTTCAAAACTATCTTATTTTTTCTAAAAGAAGCAGTACTCTAGG
TCGCATACTGTTTACAAAGAAGGTGAGACATGTGCGAATGTATACATCGTTTTCGAAGGA
GAATTTGAAATTATAAAGAAGAAATTTGAGTATGATATGATTCAATAGAATAAGAACTAT
AACTAGTACCTAGGTCCGTAATAAAATCTACAAGAATATAATGATGAGAATGAAGAGAGT
CCTCAAAAACGCACAGCTTCTTTCAGCTTACCAAGATAAGACTAAAATTACACTTAAAAG
ATTCTACTGCTTGGTAGAGGAGATATGATTGGAGAAGAAGATGCAATAAACTAAAGAGAC
TACACTTGTACTGTAAAATGCAACAGCTTAAATGGTACTTTATTAGCAATAAAAATCCAA
GATTTCTATCAGAGAATTAAGACTAATTAAGACACTTGGAAATAGATATAAAACAAAGGC
ACCTAAAAAGAATTTACAACCATAAACAGCATAAATAAACAATACACCCTAGATAAAGAG
ACTAAAGAGTAGTGCAAAGATTTGGTGAGATAAAAATTGCAAGACATAGAGATTTAAGAC
ATCGATTTTTTCAAGACTATGTTTTGGGGAGAACCAATTCCTCCTAGGAAAATAGATAAA
ATAATTGAACTTAATTAGAACATGCGAGAAGCAAGCAAAATTAAAAGAGATTACTAAAAT
TACACTAAAAAACCTAACTTTATTTAAAGCTTTATGAAGAAACTAAGAGCAGTTGAAGTT
ATAAGCTAAGACTTTTTCAAGAAACAATATTGCGAGTAATTAACCTAAAACTATAATTAA
TCCTTCTCAATTAAGTGA


>Contig6878.0.g46(protein)
MYNLVKSVLAMNNATQEQIQQSRMLQQILSILKRPSETRKDNEIKQLIPYLKQIKFFQER
QEIMKESDFLFLCERATYEHYNPHRVIFNYGDYGEKFYIILEGQVSVLLPRKRERTSQNE
NDSHEANQNFDQPQLPNSPLRSPAKTNVIDRLRNATSRLIQDVKQSNSFFVEVGQIKSGQ
GFGELALISNKLRSATIKASLDTHLLVLQRKDFEKVLQRQEEANIQKTVDFLKNMPQFKN
WTKNSLSKLSYFFQKKQYSRSHTVYKEGETCANVYIVFEGEFEIIKKKFEYDMIQQNKNY
NQYLGPQQNLQEYNDENEESPQKRTASFSLPRQDQNYTQKILLLGRGDMIGEEDAINQRD
YTCTVKCNSLNGTLLAIKIQDFYQRIKTNQDTWKQIQNKGTQKEFTTINSINKQYTLDKE
TKEQCKDLVRQKLQDIEIQDIDFFKTMFWGEPIPPRKIDKIIELNQNMREASKIKRDYQN
YTKKPNFIQSFMKKLRAVEVISQDFFKKQYCEQLTQNYNQSFSIK