Identifiers and Description

Gene Model Identifier

Contig6862.0.g21

Standard Name

None

Aliases

Contig6862_0_g21

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001512704.997699094967085e-82Mitochondrial carrier protein
SGDYKL120W4.001501063932074e-49OAC1 SGDID:S000001603, Chr XI
from 217344-218318, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6862.0.g21(coding)
ATGAGCACAACATCAATAATTGAACATCCAAATTAAAACATGAAAAATAATGTAGCCAGA
TTGCTATTTGGAGGCATATCTTGTATGACTGCAGCTACTTGCACAAATCCTGCTGATGTA
GTTAAGGTAAGACTATAGATTTAGGGAGAGAAAGGTATGGCACTAAATTAAGCCTATAAT
AACATATTCAGAGCAGCTTATGTGATATTACAAAATGAAGGACTTCGTGGATTATATAAA
GGTATTACTGCTTCATGGCTTAGAGAAGGTTCATATTCAGCTATAAGACTTGGTCTCTAT
GAACCATTTAAGGGACTTCTCGGTGAGACTGACCCTAAAAACACTCCTCTTTGGATCAAA
TTTGCAGCTGGATCAATGTCAGGTGGTGTAGGATCATTCTTTGGCAATCCAGCTGATTTA
TTGAAAATAAGAATGTAAGCTTATGAGCAATCTCCATCCAAATCACTTGTCTGGCACTCT
AAATAAATTTATGGATGTTTTGGAATTGGAGGGTTTTACAAAGGTTTATAAGCTGCTGTT
ATTAGAGCTATGATTCTTAATGCATGCTAACTTGGAACTTACGATCATGTGAAACATGGG
ATATTGAGAATGAAATTATTGAGAGATGGGCCAATGTGTCATTTTGTAAGTAGTATATGT
GCAGGAATTGTTATGGGACTTGCTACTTCACCAGTAGATGTTATCAAAACAAGATTAATG
AACTAATCAACAGACACAGCATCTTCTCGTCACTATAATGGGTTCATAGATTGCTTAAAA
GGCATTTACACAAACGAGGGTCTAAGAGGTTTCTACAAAGGGCTTACAGCATAGTGGGCA
AGATTGGGACCTTTTACAATTTTTTAACTAATGGTATGGGAGAAACTTAGAAAATTGTAT
GGAATCTAAGCAATTTGA


>Contig6862.0.g21(protein)
MSTTSIIEHPNQNMKNNVARLLFGGISCMTAATCTNPADVVKVRLQIQGEKGMALNQAYN
NIFRAAYVILQNEGLRGLYKGITASWLREGSYSAIRLGLYEPFKGLLGETDPKNTPLWIK
FAAGSMSGGVGSFFGNPADLLKIRMQAYEQSPSKSLVWHSKQIYGCFGIGGFYKGLQAAV
IRAMILNACQLGTYDHVKHGILRMKLLRDGPMCHFVSSICAGIVMGLATSPVDVIKTRLM
NQSTDTASSRHYNGFIDCLKGIYTNEGLRGFYKGLTAQWARLGPFTIFQLMVWEKLRKLY
GIQAI