Identifiers and Description

Gene Model Identifier

Contig686.1.g63

Standard Name

None

Aliases

Contig686_1_g63

Description

Glutathione S-transferase, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam02798 ) Glutathione S-transferase, N-terminal domain
  • ( pfam13417 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002052009.995317835403734e-19Glutathione S-transferase, N-t
erminal domain ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig686.1.g63(coding)
ATGGAAACTTAAGATACACAAGGCAATTTCCCCTCTACCCCACTCCACTTGACTTATTGG
AATTGCAGAGGCAGAACTTAGCATGTTCGTTACGTCCTCGAGGCTATTGAGGTACCCTAT
GAGGAGACGAGATATGAAATATCTTAATACTAAGATTGGATTGATAAAGACAAGCCCGAA
CTAGAGGGCACTTTAGCATTGCCAAATCTTCCACATTTGAAAGATGGAGATGTTCATATA
ACAGAGCATGATGCAATAATGAGATATCTCGCTAGAAAGTACAAGCCTGAAATGCTAGGA
AGAAATGACAAAGAATACGCTTTGATGGAGAACTACTTATGTTATATTACCAAGTTTTAC
ATGAAATTGGGGGAGTTCTGCTACTATACAGATCCAACAGAGGAAAACAGATTGAAGCAC
ATTGAAAGCCTTCATTCAGAGATGAGCAAATTTGATAAGATTTTCTAAGAAAGCTACTGA


>Contig686.1.g63(protein)
METQDTQGNFPSTPLHLTYWNCRGRTQHVRYVLEAIEVPYEETRYEISQYQDWIDKDKPE
LEGTLALPNLPHLKDGDVHITEHDAIMRYLARKYKPEMLGRNDKEYALMENYLCYITKFY
MKLGEFCYYTDPTEENRLKHIESLHSEMSKFDKIFQESY