Identifiers and Description

Gene Model Identifier

Contig672.0.g98

Standard Name

None

Aliases

Contig672_0_g98

Description

Phosphoribosyl transferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam00156 ) Phosphoribosyl transferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYML022W2.0003218023735366e-33APT1 SGDID:S000004484, Chr XII
I from 228937-229500, Gen...
T. thermophilaTTHERM_000111802.000470901975128e-28Phosphoribosyl transferase dom
ain containing ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig672.0.g98(coding)
ATGGTAGAAGAGCAATCAGCTGGAGGCTGTGATTTGACAGAATTCAAGGACAAATTAACT
CGTGAAGTACTTCCAAAGACAAAATTTTTCAAAGACTTCCCAAAGAAAGGCCTCAACTTC
TGTGATATTTTCTCAATTACCACAGAACCAGCTATTTTCAGAAAAGTTATCGATGGTCTT
AAGCATATGATTGAAGTTGAGATTGGCAAGCCAGGTGAGGCCTTCAATTATTTCGTTGGT
ATGGAATCTAGAGGCTTCTTAATAGCACCAATTCTCGCAGCAGAATATGGACTTCCATTC
ACTGCTATTAGAAAGAAGGGCAAACTCCCAGGTCCAATCTTTTAAGAGGAATACTAACTC
GAATATGGTTCAGATATCTGCGAGATTCAACAAAACGTTTTAAATGAAAAATGTAAAGTA
GTACTTCTTGACGATCTCTTGGCTACTGGAGGAACCTTAGCAGCAGCTATGAGTCTCGTT
GGAAAATGTGATGGAGCTACTATTGTAGGAAGCGTTGTAATTTTCGATATCCCATTCTTA
AAGGGAAGAGATAAATTGAGCAGACCATGCCACTCATTAATTAGCTTGACTTAGGAAGCC
ATCGATGAGCTTGTCCCACCACAGGAATGA


>Contig672.0.g98(protein)
MVEEQSAGGCDLTEFKDKLTREVLPKTKFFKDFPKKGLNFCDIFSITTEPAIFRKVIDGL
KHMIEVEIGKPGEAFNYFVGMESRGFLIAPILAAEYGLPFTAIRKKGKLPGPIFQEEYQL
EYGSDICEIQQNVLNEKCKVVLLDDLLATGGTLAAAMSLVGKCDGATIVGSVVIFDIPFL
KGRDKLSRPCHSLISLTQEAIDELVPPQE