Identifiers and Description

Gene Model Identifier

Contig6385.0.g21

Standard Name

None

Aliases

Contig6385_0_g21

Description

Cytidine and deoxycytidylate deaminase zinc-binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004981801.000499495426459e-47Cytidine and deoxycytidylate d
eaminase zinc-b...
SGDYHR144C2.000364041471746e-45DCD1 SGDID:S000001187, Chr VII
I from 388726-387788, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6385.0.g21(coding)
ATGATAATTGGATTAACAGGCCCTATTTGTTCAGGCAAGAGATCTCTAGCTGAATATCTC
CGTGATAAATATGGGTTCATAATCATAGATCTGCTATTCTTATTCTAATAAACTGATGAT
GCTTTTATCTCTTCACCATTAAAACCTCAAAGAGACTTTTTGGATGATTTTAGAGAATAA
AACTAATTATCAACAACATCAAATTCCATAAATGTTGATGATGTATATTTTGATGAAGCA
CTTTTGCAAAAAATGAGCGAAAAAGATAATGATCAAGATGCCTTCAGCTTCGAATTCTAT
CAAAAAAAATTCAAGGGTGACAGAGTCAAACTTATCAAAAATGTGTTTAGAAAAATTACT
AGTGACTGGTCTAGGCATTATGTCATTTACCCACTCAGCTCTTGTGAGGAAATTCAAATT
ATGATATCGAGATATTACTTCATCTTATATGAGTTAGACGCTCCTATAAAGCAGAGATAC
CTAAGATTTAAGAATAAGTATTTGGAATAAAACTAGATATCATTAGAGGAGTTTGTTGAT
CTAGATGATAATATAAACTTCAACAAGTAGGAGTATTCATTGTATAAGGCAGATGAGTAG
CATCAATTATTGATTAAAAGAAGATTTCATAATGCAGACACCCTTGAGAAGTTTCATATT
ACTTTGGATGACTTTAAGTTTGATGATAAAGAACATGTGAGACCATCTTGGGATACTTAT
TTCATGAAATTCGCAGAATTAGCTGCTTAGAGATCTAACTGCATGAAACGTGGAAACGGT
GCAATTATAGTGAAGGACTTCAGAATAGTTTCAACTGGTTACAACGGCACCCCCTTCAAG
CATCTAAATTGCAACGAGGGTGGTTGCAGAAGATGCAATTCGAATGTAGCCCAAGGTCTT
GAACTAGATAAGTGCAAGTGTCTCCATGCTGAGGAAAGTGCTGTTATCGAAGCAGGCAGA
CCCAGAACCCTGGACAGCACTATCTACACAACCAGCTTCCCCTGTTTGTTATGCACTAAG
ATTATCATATAAGCTGGAATTAAAAGAGTTGTGTATAACAAAAATTACGACAGCGTCCTC
TCAAGAGAGATGCTCAACGATTCTGAGATCGAGTTAGTTTAACATATTGTATGA


>Contig6385.0.g21(protein)
MIIGLTGPICSGKRSLAEYLRDKYGFIIIDLLFLFQQTDDAFISSPLKPQRDFLDDFREQ
NQLSTTSNSINVDDVYFDEALLQKMSEKDNDQDAFSFEFYQKKFKGDRVKLIKNVFRKIT
SDWSRHYVIYPLSSCEEIQIMISRYYFILYELDAPIKQRYLRFKNKYLEQNQISLEEFVD
LDDNINFNKQEYSLYKADEQHQLLIKRRFHNADTLEKFHITLDDFKFDDKEHVRPSWDTY
FMKFAELAAQRSNCMKRGNGAIIVKDFRIVSTGYNGTPFKHLNCNEGGCRRCNSNVAQGL
ELDKCKCLHAEESAVIEAGRPRTLDSTIYTTSFPCLLCTKIIIQAGIKRVVYNKNYDSVL
SREMLNDSEIELVQHIV