Identifiers and Description

Gene Model Identifier

Contig6325.0.0.g28

Standard Name

None

Aliases

Contig6325_0_0_g28

Description

E1-E2 ATPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00122 ) E1-E2 ATPase
  • ( pfam00689 ) Cation transporting ATPase, C-terminus
  • ( pfam00702 ) haloacid dehalogenase-like hydrolase
  • ( pfam00690 ) Cation transporter/ATPase, N-terminus
  • ( pfam13246 ) Putative hydrolase of sodium-potassium ATPase alpha subunit
  • ( pfam12710 ) haloacid dehalogenase-like hydrolase
  • ( pfam08282 ) haloacid dehalogenase-like hydrolase
  • ( pfam13192 ) Thioredoxin domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010843709.997093137033517e-262calcium-translocating P-type A
TPase, SERCA-ty...
SGDYGL167C1.000274544751666e-156PMR1 SGDID:S000003135, Chr VII
from 190468-187616, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6325.0.0.g28(coding)
ATGGAGAAAGGTTAGGAAAACAAACTCAAGGCTACGGCCATGGCATTATAGAAACTTGAT
CTTAAAGAGTTTCAGTATCATAAGTAAACAGTAGAAGAAGTCGTCTAGGAGATTGCGACA
GATTTGAAAACTGGTCTCTCATCTAAGGAGGCCGAAGCTCGCCTCTTGAAGTATGGTCAC
AACTAGCTTGAAAAAGAAGAGGAAGAGTCTCTGTTTGAGAAAATCAAAGAACAATTTGAA
GACTTGCTTGTTAGAATATTGCTTCTAGCTGCTATCGTATCATTTATAATCGCTATCACT
GGCGATGGAGAAGAGGGTATAACCGCATACGTAGAGCCCTTCGTTATTTTGACTATCTTG
GTCCTTAATTCAGTAATCTCAATCTGGCAAGACTCAAATGCTGACAAGGCTCTTGAGGCT
TTGAAGGAAATGCAAGCCGTAGAGTGCAAACTTTTGAGAGATGGCGTGTGGTCTATTCAC
GACTCCAAAAATTTAGTTCCAGGAGATGTCGTCGAAGTTAAGATTGGAGACAGAGTCCCT
GCTGACTTGAGAATTGCATAACTAAAGTCAGTCTCACTATAAGTCGAAGAGGCCCCACTC
ACCGGAGAGTCCGTATCAGTTCAAAAGACTATCAAGCCCATGCCTGCTTCAGCTTAACTC
TTGCAAGACCAAAAGAACATGCTTTTCTCTTCAACCGTGATCAATTATGGTCAAGTTGTC
GGCATAGTAGTCTATACTGGTATGCAAACTGCCATCGGTAGAGTACAATAAGAGGTTGCT
GGTGCTGCTCTCGAGGAAGAAGACACCCCATTGAAGAAGAAGCTCGACTCCTTTGGAGAA
TTATTGTCTAAGATTATTGCTATTATTTGCTTCTTAGTCTGGATCATGAACTTCAACAAC
TTCTTCGATAAGATGCACGGCTCTGCTATTAAGGGCTGTATTTACTACTTCAAAATTGCA
ATTGCTCTTGCAGTTGCCGCTATTCCAGAAGGTCTTCCAGCTGTGATCACTACTTGCCTT
GCTCTTGGAACTAGAAAGATGGCTGCTAACAATGCTATTGTTAGAAGACTACCTTCAGTT
GAGACCCTTGGTTGCACCACTGTAATTTGCTCAGATAAGACTGGAACCTTAACCAAGAAT
CAAATGTGCGCTGTTAAATTCGCTCATATTGGAACTTCAATCAATGACCTTAAGACATTC
GAAATCGAAGAGAAATCATACAGCCCAGAAGGACAAGTTAAGGGATTGACCCAAGATATT
TACCAAAGAGTCAGTGCTATTAGAGAAATTGCTGCAGTATGCACTCTTAACAACAAATCT
GATATCGTATTCGAAGATGGAAAATACAACAAGATAGGTGAGCCAACTGAAGCCGCCCTT
AAAGTCGCTGCTGAAAAGCTAGGTCAATTTGACAGAGCTCTTGGAGGAAAGGTTAACTAT
TCACAATCACCAACTGCATATGCTGCTCACCTCAGAAGATCAATTAATGATGTCGCTACT
CTTGATTTCACTAGTGAGAGAAAGACTATGTCAACTGTTGTTAGAGGTTATGATGTATTC
AGTAACACTCAAGGTCCAAACACTCTACTTTTGAAGGGAGCACCAGAAAGAGTTATTGAG
AAATCAAAGAACTACAAGAGAGAAGATGGCACAATTGTTGATTTCACTGAAGCTGAAAAG
AGAGATCTCATTAACAGAATCCAACTTTTCGCTAAAGAAGGACTTAGAGTATTGGGACTT
GGTGCCTACTATGGCGCTGGAAAATTATCTGACTTAAACGAACAAAACACTGAAGCTAAG
TTAGGAGATATCAACAAATATGCCGACTACGAAAACGGAGGAACCTTCTTAGGTATTGTT
TGCATCAAGGATCCAGTTAGAGAGGAAGTTAAGTCAGCTATTAGCGATTGTAAGACTGCA
GGTATTAGAGTCATTATGATTACTGGTGACAGCAAAGAGACTGCAGTTGCTATTGCTAAA
GAAATCGCTATTATTGATGAAGATGGACCAAACACTAGTTTCACTGGTACAGAATTTGAA
GCCCTTAGTCCAGCACAAAAGAAAGCTGCTCTTAGTGGATCAGGTGGAAAGGTATTCTCA
AGAGTAGAACCAAGACACAAGAGAGAACTTGTTAAGATCCTTATTGAAATGAACCAAATT
GTTGCTATGACTGGTGATGGTGTTAACGATGCCCCTGCTCTTAAATAAGCTCACATTGGT
ATCGCAATGGGTATCACTGGAACCGAAGTAGCCAAAGAAGCTTCAGATATGGTACTTGCT
GACGATAACTTCGCCACTATTGTTAAGGCAGTTGAAGAAGGAAGAGCCATCTACAGCAAC
ATGAAGGCTTTCATTAGATATTTGATTTCTTCAAACATTGGAGAAGTTGCCAGTATCTTC
CTCACTGCTATGCTTGGTGTTCCAGAAGGTTTCACTTCAGTTCAATTGCTATGGGTTAAC
TTGGTCACTGATGGTCCCCCAGCAACTGCTCTTGGATTCAACCCACCTGACAAGGATATC
ATGAAACAACCACCCAGAAGTGCTGATGATCAACTTATCAGTGGATGGGTATTCTTTAGA
TATATGGTTATTGGTATCTATGTCGGATTAGCCACTGTAGGAGTTTTCATTTACTGGTAT
CTCTATGCTGAAACTGGAGATGGTCACAGTCATGTAACCTTTGAGCAATTATCAAACTGG
TCAGAGTGCCCATCATGGCCTGTTGGTTCATTCACTCCATCTAACTTTGGAGGTCTCGAT
TTCACAAGCAACCCTTGTGAGTACTTCACCAAGGGTAAGGTAAAGGCCAGCACTTTGAGT
CTTTCAGTATTAGTCGTTATTGAGATGCTCAACGCTCTTAATGCCCTTTCTGAGGACAAT
TCTCTTCTTGTGATACATCCATTCGTCAACTTATGGCTTATTGCTGCTATTATTGCTTCA
ATAGCCAGTCACATGTTCATCCTCTACGTTCCAGTCATGAATTCAATCTTCGGAATTACC
CCACTCAACTGGGAAGAATGGCAACTTGTTATTGCTTTCTCAGTACCAGTTATTTTGATT
GATGAGGTCCTTAAGTTCTTCGGAAGAATCATGAATGAGAGAGAGTTGAAACAGAGACTA
TAAGTACTAGCTGATGAGAAGAAATTCAAATGA


>Contig6325.0.0.g28(protein)
MEKGQENKLKATAMALQKLDLKEFQYHKQTVEEVVQEIATDLKTGLSSKEAEARLLKYGH
NQLEKEEEESLFEKIKEQFEDLLVRILLLAAIVSFIIAITGDGEEGITAYVEPFVILTIL
VLNSVISIWQDSNADKALEALKEMQAVECKLLRDGVWSIHDSKNLVPGDVVEVKIGDRVP
ADLRIAQLKSVSLQVEEAPLTGESVSVQKTIKPMPASAQLLQDQKNMLFSSTVINYGQVV
GIVVYTGMQTAIGRVQQEVAGAALEEEDTPLKKKLDSFGELLSKIIAIICFLVWIMNFNN
FFDKMHGSAIKGCIYYFKIAIALAVAAIPEGLPAVITTCLALGTRKMAANNAIVRRLPSV
ETLGCTTVICSDKTGTLTKNQMCAVKFAHIGTSINDLKTFEIEEKSYSPEGQVKGLTQDI
YQRVSAIREIAAVCTLNNKSDIVFEDGKYNKIGEPTEAALKVAAEKLGQFDRALGGKVNY
SQSPTAYAAHLRRSINDVATLDFTSERKTMSTVVRGYDVFSNTQGPNTLLLKGAPERVIE
KSKNYKREDGTIVDFTEAEKRDLINRIQLFAKEGLRVLGLGAYYGAGKLSDLNEQNTEAK
LGDINKYADYENGGTFLGIVCIKDPVREEVKSAISDCKTAGIRVIMITGDSKETAVAIAK
EIAIIDEDGPNTSFTGTEFEALSPAQKKAALSGSGGKVFSRVEPRHKRELVKILIEMNQI
VAMTGDGVNDAPALKQAHIGIAMGITGTEVAKEASDMVLADDNFATIVKAVEEGRAIYSN
MKAFIRYLISSNIGEVASIFLTAMLGVPEGFTSVQLLWVNLVTDGPPATALGFNPPDKDI
MKQPPRSADDQLISGWVFFRYMVIGIYVGLATVGVFIYWYLYAETGDGHSHVTFEQLSNW
SECPSWPVGSFTPSNFGGLDFTSNPCEYFTKGKVKASTLSLSVLVVIEMLNALNALSEDN
SLLVIHPFVNLWLIAAIIASIASHMFILYVPVMNSIFGITPLNWEEWQLVIAFSVPVILI
DEVLKFFGRIMNERELKQRLQVLADEKKFK