Identifiers and Description

Gene Model Identifier

Contig6272.0.g55

Standard Name

"POLR3B,"

Aliases

Contig6272_0_g55

Description

RNA polymerase Rpb2, domain 6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000856509.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit fam...
SGDYOR207C9.997093137033517e-262RET1 SGDID:S000005733, Chr XV
from 733457-730008, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6272.0.g55(coding)
ATGACTGATTAAAATATCGAAATGAATGACCATGCTAATGGGAATGAGTTTAATGAACTT
TTCAATGACTTAAAATTAAACGAACCTCTTAAGAAAATAGAAGACAAATGGAAATTAGTG
CCTGCATTCTTGAGACTCCGCGGTCTTGTGAAAGCTCACATAGATTCATACAATCATTTC
TTGAATGTAGATCTTAAGGAAATTATAAGAGCCAATTAGTTTATTACATCAGATATTGAT
CCAGCTTTTTATCTCAAATTCACAGATATTCATGTTGGAATGCCAAAGATTGAAGAAGAT
TTTGAGTAGCATAATTTAATGCCTCATGAGTGTAGAATTAGAGATTTGACTTACTCTGCA
CCGATTTATGTTGAAATTGAGTACACCAAGGGCGATAGAATTTACCTGAAAAATGAAGTG
CTTATTGGAAGAATGCCAATGATGCTAGGTGCAAGCAACTGCTGGTTAAATGGCATGTCC
CACGAACGCCTAGCCTCAATCAAGGAATGCCCATACGACCCAAGAGGCTACTTTATTATC
AAGGGAGTCGAGAAGGTGCTGCTCATTCAAGAATAAATGTCAAAAAATAGAATCATCATT
GAATTGGATTCAAAGCAGAATGTTTGTGCTTAAGTCACATCAAGCACTTATGAGAGGAAA
AGTAGAACTACAATTGTTCATAAGAATGATAAGTTTTATCTTAAACATAACACATTCACA
GATGATATTCCAGTTGTTGTAGCTTTCAAAGCTATGGGAATGGAAACTGATTAGGAAATT
GCTCAAATTATTGGCACAGAAGCTAAATATCTCGATGGTCTGGCTCTCTCCCTATAAGAA
GCATCTCAATTAAACATCTTATCTCAAGCTTAAGCTCTTGAATTCATTGCCAATAAAGTA
AAAAGTTTAAAGTCTTTTTAAGGAAGACCTAAGACTAAACTAGAAGAAGCAAGAGATATC
CTCACTAACGTTGTATTGGCTCACATTCCAATGTCAGCACACTTGCCTTATTTTGCTAAA
TGCAGATATCTAGGTATGATGATAAGAAGAATTATTGAAGCAGTACATGACCCCTCAAAA
CTTGATGATAAAGATTACTATGGTAACAAACGTTTAGAATTATCTGGGCAGCTTATATCA
CTGCTATTTGAAGATTTATTTAAGAAATTCCAATTTGACTTGAAGAAGTAAATTGATATA
ATGCTTGTTAAATAAAAAAAGGAAAAGTTTGATGCTTTAACATGCATTAAACCTGATACT
ATTACTTAAGGACTGGAGATGTCAATCAGCAGTGGTAATTGGTCACTAAAGAGATTCAAG
ATGGAAAGGAAAAGTGTTACTTAGGTGCTATCCAGATTATCCTACATTGCAGCCTTAGGT
ATGATGGCAAGAATTAACTCTCAATTCGAAAAGACAAGAAAGATATCAGGTCCAAGAGCT
TTGCAGCCATCTCATTGGGGTATCATTTGTCCATCTGATACACCAGAGGGTGAGTCCTGC
GGTCTTGTTAAAAATTTAGCCTTGACAACTCATGTGACTACAGACTCCCCAGAGAAGCCA
CTCCTAAGAATTTGCATTGATCTTGGTATGGAGGATGCTGCACTTCTAGGTGGTGATGAA
CTGTATTCAAAAAATCACTTCCTCGTGTTTTTGAATGGATAACCTATAGGTGTGGTCAAG
CAACCTCATAAATTCGTGAGAAACTTCAGATTCTTGAGAAAAAGAGGACGTGTTCAAGAA
TTTGTTAGTGTGTATATGAGTGAACAGCAAAACACAATAAATATCGCTTCAGATGCTGGA
AGATTAGTGAGACCATTAATTGTTATTGAGAGAGGTAGACCTAAGCTTCAGCAATCACAA
ATTCAAGATTTAATATTGGGACTCCGTGATTTCAACGATTTCTTAAGAGAGGGACTTTTG
GAGTACCTTGATGTTAACGAAGAAAATAATGCTTTGATAGCTTTAAATGAGAACGCTTTA
ACTCAAGCTCATACTCACATGGAGATAGATCCCTTGACTATTTTAGGATGTGTTGCTGGT
CTTATCCCCTATCCTCATCACAATCAAAGTCCCAGAAATACTTATCAATGTGCTATGGGT
AAATAAGCAATTGGTTCAATAGGTTTAAACTAACTCAATCGAGTTGACACTCTCCTCTTT
CTCTTGACACATCCTTAAAAGCCACTTGTTAAGACAAAAACCATAGAAATCATTAACTTT
GAAGAATTACCTGCTGGGTAGAATGCATCAGTTGCAATTATGAGTTATAGTGGTTATGAT
ATAGAAGACGCAGTGGTTCTTAATAAAGCTTCACTTGATAGAGGGTTTGCTAGAGCTATG
TACATAAGAAGATATCAGACAGACATAAAGAAATACTCAAACGGAGCCACAGATATAATT
CTTCCAGGAGTATCCCAGAAAGATTAAAAGAGGGCCTTCAACAAGAAATTCCATGCTCTG
GATGAAGATGGAATGGCACGTGTTGGTGAAAGTTTACAAAATGGCGATGTCTTCATTAAC
AAATACACCCCAGTAATGGGTGAAAATTAAACTGGTTACTTGAATGAAATTGATCTTACT
ACGTTGGAGTATAAGAGTCAAGCTTAGTCTTACAAAGGCGCTAATCCTGCTTACGTGGAT
AGAGTTATAATGACATCTACCCCTGAAAACCCTTTCTTTATTAAGATGATCACTAGACAA
TCGAGAGTACCAGAAATTGGAGATAAGTTTAGTTCTAGACATGGTCAAAAGGGTGTTGTT
GGTCTAATTGTTCCATAAGAAGATTTACCATTTAGTGAAAGAAATGGTTGGTGTCCAGAT
CTTATCATGAATCCACATGGTTTCCCATCACGTATGACAGTAGGTAAGATGATTGAGTTA
ATTAGTGGAAAAGCAGGAGTACTCGAGGGTGAGTTCAAATATGGAACAGCTTTCTCCGGT
GACCCAGTTGAGGAAATGGGAAAGTTACTGATCAAACATGGTTACAGCTTCGATGGAAAA
GATGTTTTAATGTCTGGAATAACTGGTGAAGTCTTGCCTTGCTTCGTGTTCTCAGGGCCA
ATCTATTATTAACGTTTAAAGCATATGGTCCAAGACAAAATGCATTCAAGAGCTCGTGGT
CCAAAGTCTGTCCTGACTCGTCAACCTACAGAAGGTAGATCCAGAGAGGGTGGTCTAAGA
CTTGGAGAAATGGAGCGAGATTGCTTGATTGGTTACGGAGCAGCCAATCTAATTATGGAG
CGTTTAATGATCTCATCAGATCAGTTTGTAGTTTATATTTGCAATAGATGCGGATTCTTA
GGCTATGAAGGGCATTGTGTGTACTGCAATCCTCATCACGATAATGTATGCAGTGTTAAG
ATGCCTTATGCTTGCAAATTACTATTGTAAGAGTTGCAAAGCATGAACATTAGAGCATAG
ATTAAACTCACTGATGTTTGA


>Contig6272.0.g55(protein)
MTDQNIEMNDHANGNEFNELFNDLKLNEPLKKIEDKWKLVPAFLRLRGLVKAHIDSYNHF
LNVDLKEIIRANQFITSDIDPAFYLKFTDIHVGMPKIEEDFEQHNLMPHECRIRDLTYSA
PIYVEIEYTKGDRIYLKNEVLIGRMPMMLGASNCWLNGMSHERLASIKECPYDPRGYFII
KGVEKVLLIQEQMSKNRIIIELDSKQNVCAQVTSSTYERKSRTTIVHKNDKFYLKHNTFT
DDIPVVVAFKAMGMETDQEIAQIIGTEAKYLDGLALSLQEASQLNILSQAQALEFIANKV
KSLKSFQGRPKTKLEEARDILTNVVLAHIPMSAHLPYFAKCRYLGMMIRRIIEAVHDPSK
LDDKDYYGNKRLELSGQLISLLFEDLFKKFQFDLKKQIDIMLVKQKKEKFDALTCIKPDT
ITQGLEMSISSGNWSLKRFKMERKSVTQVLSRLSYIAALGMMARINSQFEKTRKISGPRA
LQPSHWGIICPSDTPEGESCGLVKNLALTTHVTTDSPEKPLLRICIDLGMEDAALLGGDE
LYSKNHFLVFLNGQPIGVVKQPHKFVRNFRFLRKRGRVQEFVSVYMSEQQNTINIASDAG
RLVRPLIVIERGRPKLQQSQIQDLILGLRDFNDFLREGLLEYLDVNEENNALIALNENAL
TQAHTHMEIDPLTILGCVAGLIPYPHHNQSPRNTYQCAMGKQAIGSIGLNQLNRVDTLLF
LLTHPQKPLVKTKTIEIINFEELPAGQNASVAIMSYSGYDIEDAVVLNKASLDRGFARAM
YIRRYQTDIKKYSNGATDIILPGVSQKDQKRAFNKKFHALDEDGMARVGESLQNGDVFIN
KYTPVMGENQTGYLNEIDLTTLEYKSQAQSYKGANPAYVDRVIMTSTPENPFFIKMITRQ
SRVPEIGDKFSSRHGQKGVVGLIVPQEDLPFSERNGWCPDLIMNPHGFPSRMTVGKMIEL
ISGKAGVLEGEFKYGTAFSGDPVEEMGKLLIKHGYSFDGKDVLMSGITGEVLPCFVFSGP
IYYQRLKHMVQDKMHSRARGPKSVLTRQPTEGRSREGGLRLGEMERDCLIGYGAANLIME
RLMISSDQFVVYICNRCGFLGYEGHCVYCNPHHDNVCSVKMPYACKLLLQELQSMNIRAQ
IKLTDV