Identifiers and Description

Gene Model Identifier

Contig624.1.g115

Standard Name

None

Aliases

Contig624_1_g115

Description

FOP N terminal dimerisation domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam09398 ) FOP N terminal dimerisation domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005374206.997498932278805e-30hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig624.1.g115(coding)
ATGGACGAATTGAAAAATTTAGTAATCTAGACTCTCGAGACCAATGGTATTTTGGGGCAA
TTGCGAGCTCAACTGAGATCGTGCGTGTTCAAGGTAATTGATAATCAGGATACTATTGAG
AAGGGACAGTCGGGATTCCACTGGGAAAACCCTAATGCTCGTAAGGTAATGCAACATGCA
AGTGGAGTGATCTGTGCTGAATTAGTAAAAGAATTCTTAGAATTCAACAAACTAGATTAC
ACTCTAGCAATTTTCATGCCAGAAGTAAACCTAACAGCTTAAAACAGCATGTCAAAAGAG
GAACTCTCCCGCAAAGTGGGTCTTAGTGATCCCTCCCCAAACAAGCCAATAATGGCACAA
CTAGTGGAGAGTTTCTTGTCAAACGACAGACCAGTCTCTTCTATGAGCAGCAACAAATAA
AAGGCTGAGGAGAAGTCGCTCAATGCACAGATTAGTCAACACAAAGCAGCTGCTGCTCCC
AGTAACTATGCACTCCCAGATACCTATGCCAATAAATATGATAACAGCAAAAATAACAAC
AGTGATAGCAGTGGAAACAACAGTCATAGCAGCAGCAGAGACAATGTTGCTGATATCTCC
AAGAACTCAGTCAAGTCTGCCTCTAATGTCAATACTTATCAGTAACCACCTAAACAAGAA
GAGAAGTCAATTACAGATAGTCATTTAGAGAGAGCAAATCGCATGTTAGAGGAGCATAAG
CGTGAAGAAAAATCGGGATATCAATTTGCACCAACTAACGACAACAATAATAATAAATCA
GGAAAGTACAGCAAGAGGGAAGATGATTTAATTGATACTTATGGAGATGACTTTGAGGAG
GAAATCGAAGAGGACCTACCAGATGATACCAACCACTTGCTCGACTCAAATGATGGCGGT
AACCACAAGGGCATTACTGAGAGTGCTGGAGGCATTACTGTTAGTCAATCACTTGGAGTG
GATCCTAGTGTTGACTCCCTTGCTTTGGAGGATTATGACCATATTGAACCAGTGGAGAGA
TTAAGTTGA


>Contig624.1.g115(protein)
MDELKNLVIQTLETNGILGQLRAQLRSCVFKVIDNQDTIEKGQSGFHWENPNARKVMQHA
SGVICAELVKEFLEFNKLDYTLAIFMPEVNLTAQNSMSKEELSRKVGLSDPSPNKPIMAQ
LVESFLSNDRPVSSMSSNKQKAEEKSLNAQISQHKAAAAPSNYALPDTYANKYDNSKNNN
SDSSGNNSHSSSRDNVADISKNSVKSASNVNTYQQPPKQEEKSITDSHLERANRMLEEHK
REEKSGYQFAPTNDNNNNKSGKYSKREDDLIDTYGDDFEEEIEEDLPDDTNHLLDSNDGG
NHKGITESAGGITVSQSLGVDPSVDSLALEDYDHIEPVERLS