Identifiers and Description

Gene Model Identifier

Contig605.1.g94

Standard Name

None

Aliases

Contig605_1_g94

Description

EF-hand domain pair

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007039209.999987414410742e-95EF hand family protein
SGDYDR373W0.00003998524687536623FRQ1 SGDID:S000002781, Chr IV
from 1222759-1223331, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig605.1.g94(coding)
ATGTTAGGCATAGATACACAACTTAAACTTAAGGAGTTCTTCCAAACTGTCGCTGAATCA
GAATTGCAAACTGAAAGACAAAGATAATTGTTGGCAACTGTTGCTGACTTTGAGCCATAC
GCTGCCTTCCAAAGAATAAACAGAAATAGCGATGAATTCGTGACTGCTCTCGAGATCTAC
TCATTCTTGAAAGACAACGATGTTAAGTATGTCACTTTAAAGGAATGCTAATTGTTGATT
AAGTACTTCGATCTTGATAACGATGGTGCCCTCAGATACACAGAATTCATTTAAGCTTTG
TTGCCATGTGATGACATGTACTTGAGATCAGCTGCTACTCAGAGACCCAACTATAAAATT
GGCAGATACGATAGACTTCCACTCACTGTTGAGAGAGAACTCACTAATCTTCTCGAAAGA
GAAATATCTTATCACACCAAAGTTGAGAGACTGAAGCACGAACTTCAATTGAGATACGAC
TGGTCAAACAGAGCTGCATTTGAGACCATTGACAACTTGAGAGACCACGCTCTTAACTCA
AGAAACATTCAATCATTCTTAAGATTAAACGGATTCTATGCCACTGAGAGCGAACTTGTT
GCCATCATTAGACGTTTAGATGTTGATGCAGATCAAAAGATTACCTATGAAGAGTTTATT
GAAGCATTCAGACCATAATCTATTGTTGAAAGTTCAGTACCAAGCCTAACTGCCAGCAGA
TTTGAGGAGGAGAAGAAATCCCATAGTCCCTTAAGAGATAGCACCGCAAGTGGCTTCAAC
CCCCATTAAAGCAATTATTTGGCAGCTTCATCCTTAAGCAGTTCTTCTGGTTTCAGAGCT
AGTGGACTCGGAGCATCTCCATCAAGAGGTTTAGCTCAAAGTGAACTCAGACAATCATAT
GCTTCCCCCAATAGAAGAGCCGATGTTACTAGAGACATCCTCACTAAATCTCAAAACAAG
GATTACTCATCACCTTCCAGATTCGGAACTTCATCTCTTGGAGTTTCACAAAAGAGACAA
TCTCCACTCAAGCAAGACGACGAGGATGAATTGGTAAGAGCTTTCAGAGAACAAATTAGC
CTTGAAAAGGAGTTGGAAGACGCTAAGATCAGACTCGGTTCTCAACCAGATTTCAACCTT
ATGGATGCTTTCCAAATGCTTGATAGAACTGTTAAGGGATGGGTTACTGCTCCAGAGCTT
GCTGATGTTTTATCTGACCTCGGTACTTATGCTCATAGAGACAATGTTAACTTGTTCACT
AGAAGATACGATAAGGACAGCGATGGAAGACTCCTCTATTCAGATTTCTGTGATGCTTTC
ACTCCTAAGTCTTCATCTCACGCTTTGACCCTGAACTCTCGCTCAGCATACTACCTCCAC
AATTCACATTACGCTAAGCATGAATACTTTACCAGAGAAACTAGAGACTTATTCTTGAGA
ACTTTCAAGGTACACTTTAGCGTTGAGGAAAGTGCTGAACTCCTTAGAAAGAGATTGGCA
AGAAGACCATACTTCAACGCTCATGATGCCTTCACAGCTGTAGATCAAGATAGAAACGGT
TACTTGACTAGAGATGAGTTCAAGCAAATCCTTAGAGACAACGGTTTCTATGCCACAGAC
AGTGAGATCTCAATTTTAATTGATAGATACGACAGAAATCACGATGGCAGAATTTCTTAC
TCAGAATTTATTGATGAAATTCTCCCCAAGTCACCATCTAGAAGATGA


>Contig605.1.g94(protein)
MLGIDTQLKLKEFFQTVAESELQTERQRQLLATVADFEPYAAFQRINRNSDEFVTALEIY
SFLKDNDVKYVTLKECQLLIKYFDLDNDGALRYTEFIQALLPCDDMYLRSAATQRPNYKI
GRYDRLPLTVERELTNLLEREISYHTKVERLKHELQLRYDWSNRAAFETIDNLRDHALNS
RNIQSFLRLNGFYATESELVAIIRRLDVDADQKITYEEFIEAFRPQSIVESSVPSLTASR
FEEEKKSHSPLRDSTASGFNPHQSNYLAASSLSSSSGFRASGLGASPSRGLAQSELRQSY
ASPNRRADVTRDILTKSQNKDYSSPSRFGTSSLGVSQKRQSPLKQDDEDELVRAFREQIS
LEKELEDAKIRLGSQPDFNLMDAFQMLDRTVKGWVTAPELADVLSDLGTYAHRDNVNLFT
RRYDKDSDGRLLYSDFCDAFTPKSSSHALTLNSRSAYYLHNSHYAKHEYFTRETRDLFLR
TFKVHFSVEESAELLRKRLARRPYFNAHDAFTAVDQDRNGYLTRDEFKQILRDNGFYATD
SEISILIDRYDRNHDGRISYSEFIDEILPKSPSRR