Identifiers and Description

Gene Model Identifier

Contig5966.0.g11

Standard Name

None

Aliases

Contig5966_0_g11

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000668400.0000000000010000211161514907Cyclin, N-terminal domain cont
aining protein
SGDYGR108W0.0000000010002658722841845CLB1 SGDID:S000003340, Chr VII
from 703636-705051, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5966.0.g11(coding)
ATGAACTCTTCTAAATCTATGTCTTGGCTAAGACACCCTCTCGAAGATAAGACGACTTTT
TACTAAAATAATTAGTAGTAAAATATTAATCTGAACACAACCCTCTAAGCTGGAATGAAT
CCAGGTCCCCAAACTACTACAAATGCTAACTATTAAAACGCCTTGGGTCTTAATACCAAT
CATTCAAACAACAATAATAAATAGTATTTAAATCAAGCCATTGCAAATGTACTTAATGGC
AATAAACAATACTCACATAATGCTTCAGCTGCTCAACTAGGCTCTCATAACCAATATAGA
ACTATAAATGCAAGCAGCATTTAATCATAGCAAATGCAAGTCCTTTCTCCTAAGAAATCT
CATTAGAATTTGTTAGGCAACAACAATAGACATCACAATTAAACTCAAGGAAGTAATTTA
AGAGGTGCAGCAAAAGATAATTAGAAATAATAAATATTTTGCTGTAGTGAAGGCACTTTA
ATCAAAAATGCAAACTCTAATGAGCAGATTAACTGTGGAAATTGTTCCATCTGTGGCCTC
TTCATCATGGTCAAGAAATCAGGCTAAGTAACCAGAGGAATAAGAGAGCAAGGAAAGAAT
TTTTAATTGGATCACCCGATGTCCGTGATTATTAACAACATGAAAATAAAATCACAAGAA
ACCGTGCAAATGCTCAATCCTTAAGAAGTCTATCTCAATAAAAGAAAGCAACTAGTTGAT
TGGATTAGCGGGGTAGGGGAGAGTTTAGGCATTACACCCAAAACCATTCATCACTGTGTC
CTAATGATGGATTTATACTGCTCTCTTGTTGAAACAACTATTTAAGAATCAGAGTTGTAA
TTGATATCGGTATCTTGTTTAATGATTTCAACTAAATACTATGAAATGAAATACCCAAGT
GCTTCTTCTTTAAATAGTGCTTGCAAAAACCAATATTCTTATGAGTAAATAATCACTAAA
GAAGGAGTGATTCTAAAGCAAATTAATTGGGATATGTTGCGATACACCATCCTAGATTTC
GTAGAAATTTACATTAATCAAGGCTGTCTCTTTGAAAGTGACGAAGTACTGAACAGTAAT
GGTTAAATTTAAAGTTTAAGCTCAGGCAGTAATACTCTTTAAATTCACGGTAGACATTCT
AAGTAAAATAACACCTTGTCACCAAAGGCCTAGTAAAAAAAGATTAGCAAGCAAACTTCA
GAATATTTGAAGAGATATGCTGAGTTTTTTGCTGATTTCTGTATTTAAGAAGAAAGTTTT
CTATATGTGAATCCACTCTATCTTGCTTGTGCTATTATTGCTTTTGCTAGAAAATATACA
AAGCTCAGTTTCATTTATCCACTTGAGCTTGAAGTTATGACGGGTATTAGCTATACAACA
GTTAAAGCATTGTATTAAATGCTTGAAAGTAGATATACTGAATGCTTCCCAGATCACAAC
ACAAGTAGTCATTCAAACTCTCAGCAAACTTCTTCTGTAAACAAGACTGTTATTGGTCAG
AAGATCTCTCCCAGTACTGTGAATAACAACAACTCAAGTTCAAAGAAGACTTAAGCCTCA
TCAAGCTCAAATAACATGTCAAGCAAGGGAAAATTAAAAATTGATATTGAAACACCCAAC
AAATCTCAATTTGAGTTTGGCACTATTGTAATTAAGAGCAGTGATAAGTTGAGCTCACAA
AAAACTCTTGCTTAAAAGTCAAATGCTAAATAGAGAAATCCTTCATAGATTGCTCAGCTA
AGGTTAACTACAAATCCACCAGATTCAGTTAAGAGATTTACAGTAAAGAAATCGATTATT
GGAGCATTCGACAACGCAGCTAATCACTACAACACAAATCTCTAGTCAATCAACAATTCA
GGCTTCATCAACCAATCTGGCAATGGATTGGTTATCAATACTCAGCATAATTATCAAACA
GGAAGTAGCAGAAACAAGTCAAGTATGGGCATTGGTCTTGGTCTTAAGACCGCAGTAAAC
TCAGTAAAGTAATCTTTCCATTAGTAACCTTCAATGAATAATTTGAGCGGCAACTTGAAC
TAACAGCAAAATAGTTTTCATACTATTGACCATAGTAATGCAGCTATGAACAGCAATAGC
AACTACTAGAATTGCTAGGCTCTAATCAATAAAAGAATGCAATCAAGCAAGAGCTCAGCT
TAGCTTATGATGTAATAATAGCAAAAGAAACAGCAAATATCAGACTAGTATTAAAGTATT
TAGGATAATTCTAGGAGCTCTGAGTAACTTAGAATACCAAGCGCTTCTATTGCTAACTAA
AAATAGAGTGCGAATGTATAAATCAGCAAGAATGTTAGTCAAATATAGATTGATTCGTTT
CCCAAGTTTAACAACTTCATGACTATCGACTATTCAACTTGCTTGAAAGATGCAGTGAGA
GCAAATAAAATTCCTAGATAAGGCGGTCAAAAGGTTGTCAACATCAAATTGAAGGATAAT
TAGACTTTTATCCCTCACACCACAACTAATAAAGAAAACGTTGGTATCACTTTGAATGGA
AATAATTCTAGCAACTTGCTTTAAAAGATGAATTTGGGAGGCTACTCTACCAGTAGAAAC
ATTCATTAAACTCAAAATTAATCTGCTTCTTCTTCAAACCTTCACTATAACAAAACCTCT
TAAAATATCTTGAAGTAATAGAATTCAACTACTACTCAAGCTGTAAACAACCATATCCAT
AGCTAAAACATGATCCCTACTACTTTACTTCAAAATGCAGTCAGCAATTCTCACTAAAAT
GGTGAGAACACTGGAATTATTCATAGTCGCGTTGGATCTTACGGTGGAGTAACAGGCTAG
TCAAGAACTAGTCTTAGCAGAGTTGACTTAGTAAAATAACTGAATGCTTCTAGGGAGAGA
GTCAACTCTTTAATTTTAAATTCAACACAGAATCACTCAAATAATGCTAACAATAACAAC
ACTTCAACAGGGAGTCAAGCCAGATAAAATTTAATTAAAGCACTCAATGTAAAGAGATGA


>Contig5966.0.g11(protein)
MNSSKSMSWLRHPLEDKTTFYQNNQQQNINLNTTLQAGMNPGPQTTTNANYQNALGLNTN
HSNNNNKQYLNQAIANVLNGNKQYSHNASAAQLGSHNQYRTINASSIQSQQMQVLSPKKS
HQNLLGNNNRHHNQTQGSNLRGAAKDNQKQQIFCCSEGTLIKNANSNEQINCGNCSICGL
FIMVKKSGQVTRGIREQGKNFQLDHPMSVIINNMKIKSQETVQMLNPQEVYLNKRKQLVD
WISGVGESLGITPKTIHHCVLMMDLYCSLVETTIQESELQLISVSCLMISTKYYEMKYPS
ASSLNSACKNQYSYEQIITKEGVILKQINWDMLRYTILDFVEIYINQGCLFESDEVLNSN
GQIQSLSSGSNTLQIHGRHSKQNNTLSPKAQQKKISKQTSEYLKRYAEFFADFCIQEESF
LYVNPLYLACAIIAFARKYTKLSFIYPLELEVMTGISYTTVKALYQMLESRYTECFPDHN
TSSHSNSQQTSSVNKTVIGQKISPSTVNNNNSSSKKTQASSSSNNMSSKGKLKIDIETPN
KSQFEFGTIVIKSSDKLSSQKTLAQKSNAKQRNPSQIAQLRLTTNPPDSVKRFTVKKSII
GAFDNAANHYNTNLQSINNSGFINQSGNGLVINTQHNYQTGSSRNKSSMGIGLGLKTAVN
SVKQSFHQQPSMNNLSGNLNQQQNSFHTIDHSNAAMNSNSNYQNCQALINKRMQSSKSSA
QLMMQQQQKKQQISDQYQSIQDNSRSSEQLRIPSASIANQKQSANVQISKNVSQIQIDSF
PKFNNFMTIDYSTCLKDAVRANKIPRQGGQKVVNIKLKDNQTFIPHTTTNKENVGITLNG
NNSSNLLQKMNLGGYSTSRNIHQTQNQSASSSNLHYNKTSQNILKQQNSTTTQAVNNHIH
SQNMIPTTLLQNAVSNSHQNGENTGIIHSRVGSYGGVTGQSRTSLSRVDLVKQLNASRER
VNSLILNSTQNHSNNANNNNTSTGSQARQNLIKALNVKR