Identifiers and Description

Gene Model Identifier

Contig578.1.g56

Standard Name

None

Aliases

Contig578_1_g56

Description

ADP-ribosylation factor family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL137W2.000043494209831e-96ARF2 SGDID:S000002296, Chr IV
from 216529-217074, Genom...
T. thermophilaTTHERM_007352405.999393432078778e-90small GTP-binding protein doma
in containing p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig578.1.g56(coding)
ATGGGTTCAATGTTCTCCAAAGTCTGGTAAAGACTTATTGGCAAGAAAGAGATGAGAATT
CTCATGGTCGGTCTCGATGCTGCTGGTAAGACCACCATCCTCTACAAGCTCAAGCTCGGT
GAGGTCGTCACCACCATTCCAACCATCGGCTTCAATGTCGAGACTGTTGACTACAAGAAC
ATCAGTTTCACAGTGTGGGATGTAGGCGGTCAAGACAAGATCAGACTCCTCTGGAGACAC
TACTATCAGAACACCTAAGGTCTTATCTTCGTCGTTGACTCCAACGATAGAGACAGAGTT
GATGATGCCAGAGAAGAGCTCCACAAGATGATCGCAGAAGAGGAACTCAAGGAAGCAGTT
CTCTTAGTATTCGCTAACAAGCAAGATCTTCCAGGCGCTATGACCTGCCCAGAAATCACT
GATAAGCTCGGTCTCCACACCATCAGAGGTAGAACTTGGTACATCCAAAGCACTTGCGCC
GTTACTGGAGATGGTCTCTACGAAGGTCTCGACTGGCTCTCAAAGCACGTTGTCGCAAAG
TGA


>Contig578.1.g56(protein)
MGSMFSKVWQRLIGKKEMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVDYKN
ISFTVWDVGGQDKIRLLWRHYYQNTQGLIFVVDSNDRDRVDDAREELHKMIAEEELKEAV
LLVFANKQDLPGAMTCPEITDKLGLHTIRGRTWYIQSTCAVTGDGLYEGLDWLSKHVVAK