Identifiers and Description

Gene Model Identifier

Contig5723.0.g86

Standard Name

None

Aliases

Contig5723_0_g86

Description

Sec63 Brl domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004430103.998862432046419e-53DnaJ domain containing protein
SGDYOR254C2.0009605191578312e-25SEC63 SGDID:S000005780, Chr XV
from 807023-805032, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5723.0.g86(coding)
ATGTCAAATTTCTAGGATAACTTCCATAGAGAGGAAGAGAAGCCACTAGACTATGATGAC
TCTGCTTTCTACTACTTCTTTGTGTCAATTTTAACTGTGATCTTGATTCCATTTACCATC
CACATTTTAAAGATTGTGATTATGGGAGAGAAAAAGTTCGAAGTAATTGGCATAAATTGT
GATTGCAGTAAATGTAAAGAAACCTTGAAATTGAGGAAGAATGCTTACAAGCATACATGG
ATTAAGCCAGTTTTCTTCTTTAAACTATTCCTACTAGTAGGTCTGTGGGTTCTATGGGCC
CTCACTGCTGATTAGATTAGTAAGATAGAACCACTTAAATCATTTGACCCATATCAAATA
CTTGGAGTTGATGTTGGTGCTGAACCTGCAGTCATTAAGCGTGCTTACAGAAAGCTTAGT
TTGATTAAGCATCCAGACAAGAACCCTGATGATCCACTAGCAGTGACTGAGTTCATCCAA
ATTACTAAAGCCTATACAACACTTACCGATGAAACAGCAAGAGCAAACTGGGAGAAGTAT
GGTAATCCCGATGGTCCAGGAAGCTTCTAAGTTGCTATCGCATTACCAAGATTCCTGTTA
TACAAAGAATACCATATAAGTGTTCTTGCATGCTTCTTTGTAGTTCTACTTATCATTATA
CCAGGATTCTTCTACTACAATCTTGATGCATCAAACAAGGATATTGGAGATGTAGATGTT
GAGAATAGAAGAATATTTGCCTTTTTGTTAAATGAAAACATGGTTTACAAAAACTGTCCA
ACAATTTTGGCATGCAGTATCGAATTTTAAAAGATGGGACTTAAGAATGAAAAAGAAACT
GCAATTATCAATGCAATCAAAACTGATGAAAATGTAAAAGAACTAATTCCCAAAGTTACA
CCAAACAGAGTTCCAGTGAACTTGAAAGCACTCTGCTTAACCCTTGCTTACATGCTAAGA
ATGAGTGAAGTAAATGAAACTGTGATCGAGGATGTCAACTTTATCTTGAGTAAAGCGCCA
TATCTAATGGAATAAATGCTTTAAATGGCCATGATTCTTGCAATTGAGTTCAAGTTTGGC
AGATCAAGAAAAAGAATTAATGCAAGAAATGTTCTTACTTTGATTACTTTCTCTCAAAAT
CTTATCTAAGGAATGTGGGCAGATGATGATCCATTCCTTCAACTCCCGCACATGGACTAT
GAAAACTTTAAGTTACTTAGAAGAAAGCAAAAGAACCTCACTCTTGAACAATATTGCTTA
ATGTCAGCAGAATAAAGAAAAGTTATGGATATTTACGAAAACCCACAATTCTTTGAGGAC
TCAGAGAAATCAATTAAATGCTTCCCAGTTATTGATGTTTCAATCGAATACTTTGTAGAG
GGAGAAAAGGAAATTGCAGTAGGTGATATCCTTACCATTAAACTTAAGATCACTCACAAG
AACCTTGGAGAGGATGATACCCTAGGATTTGTTCACTCAAACAGATTCCCATTCCTGAAG
CAAAGCTCATGGTTCCTTGTGTTCACTGATGCTGAGGAAAATGACTTTTTAGCTATGGAG
AAACTTGTGATCAAAGAGAAAACTTTCGTAAAGGAAATTAAGGAAAGATTATCAAGACCA
GGCAAGATGCAATTCTTTATGATCTTGAGAAATGACTCCTACAGAGGCTTTGACAAGAAG
GTTAGCGTTGCAATTGACGTCCTTGCTAATGTCGTAAGAGCTCCAGTAGAGTATGACGAG
GAAGATATCCAAGCAATGAAGGCTCCAAGCATGATGCAATAAATGATGGACATCGCTCCA
GCTGAAAATTCAGATGATGAAGACTCAGAAGATGAGACCACAAATAATTCTTCAGCTCCA
AAAGAGAAGGAGGGTCCCAATTCAGCTTCATCCGCTCCGGTCACTGAATCTCAAGAGAGC
AAGAAAGACCAATGA


>Contig5723.0.g86(protein)
MSNFQDNFHREEEKPLDYDDSAFYYFFVSILTVILIPFTIHILKIVIMGEKKFEVIGINC
DCSKCKETLKLRKNAYKHTWIKPVFFFKLFLLVGLWVLWALTADQISKIEPLKSFDPYQI
LGVDVGAEPAVIKRAYRKLSLIKHPDKNPDDPLAVTEFIQITKAYTTLTDETARANWEKY
GNPDGPGSFQVAIALPRFLLYKEYHISVLACFFVVLLIIIPGFFYYNLDASNKDIGDVDV
ENRRIFAFLLNENMVYKNCPTILACSIEFQKMGLKNEKETAIINAIKTDENVKELIPKVT
PNRVPVNLKALCLTLAYMLRMSEVNETVIEDVNFILSKAPYLMEQMLQMAMILAIEFKFG
RSRKRINARNVLTLITFSQNLIQGMWADDDPFLQLPHMDYENFKLLRRKQKNLTLEQYCL
MSAEQRKVMDIYENPQFFEDSEKSIKCFPVIDVSIEYFVEGEKEIAVGDILTIKLKITHK
NLGEDDTLGFVHSNRFPFLKQSSWFLVFTDAEENDFLAMEKLVIKEKTFVKEIKERLSRP
GKMQFFMILRNDSYRGFDKKVSVAIDVLANVVRAPVEYDEEDIQAMKAPSMMQQMMDIAP
AENSDDEDSEDETTNNSSAPKEKEGPNSASSAPVTESQESKKDQ