Identifiers and Description

Gene Model Identifier

Contig5607.0.g53

Standard Name

None

Aliases

Contig5607_0_g53

Description

ATP synthase subunit C

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

Biological Process

Domains

  • ( pfam00137 ) ATP synthase subunit C
  • ( pfam13536 ) Multidrug resistance efflux transporter
  • ( pfam00420 ) NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002183307.998077742349047e-67ATP synthase subunit C family
protein
SGDYHR026W2.0000236365077126e-43VMA16 SGDID:S000001068, Chr VI
II from 160844-161485, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5607.0.g53(coding)
ATGGCTACTCCAGACTAACTCTGCTAACTCGGTCTCTACGGAGGTTGGAAAGACATGTTC
TATTGCATCTCCCCACACTCATGGGCCTATATGGGAGTCGCTCTCTCAATTGGTCTCTCC
ATTATTGGAGCTGCTTGGGGTATCTTCATCACTGGTAGCAGTCTTTTGGGTTCAGCAATT
AAAATGCCAAGAATTAAATCCAAGAATCTTATCAGTGTTATTTTCTGTGAAGCCGTCGCT
ATCTATGGTGTTATTATCGCTATTATTCTCTTGACTAAAACTGAAAACTTGCAAAAGACC
TTCAAAAATACTGACGAACATGATGCTGCTCTCTGGGGCGCTTATGCCATCTTCGGTGCT
GGTCTCTCAGTTGGTCTCTCTAACTTATTCTGCGGTGTTTGCGTTGGTGTTACTGGAGCT
GGTTGCGCATTGTCAGATGCTCAAACCCCATCAACTTTCGTTAAGATCCTGATTATTGAG
ATTTTCGGTAGTGCCCTTGGATTGTTCGGAGTCATCGTTGGCATCATTCAAGCTGGTAAA
GCATGA


>Contig5607.0.g53(protein)
MATPDQLCQLGLYGGWKDMFYCISPHSWAYMGVALSIGLSIIGAAWGIFITGSSLLGSAI
KMPRIKSKNLISVIFCEAVAIYGVIIAIILLTKTENLQKTFKNTDEHDAALWGAYAIFGA
GLSVGLSNLFCGVCVGVTGAGCALSDAQTPSTFVKILIIEIFGSALGLFGVIVGIIQAGK
A