Identifiers and Description

Gene Model Identifier

Contig534.1.g132

Standard Name

None

Aliases

Contig534_1_g132

Description

Tetratricopeptide repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006918808.001645293484705e-131TPR Domain containing protein
SGDYBL084C4.997966074691795e-65CDC27 SGDID:S000000180, Chr II
from 69445-67169, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig534.1.g132(coding)
ATGCTTATATAGTTACCATAAAATTTTCAGGCAAACCCAGGATCCTCGGCATTTCTAACA
AAAAGGAATGCTCCTGATTTATAAACAGAAACTTCACAAGTCACCTCATAGTTTGGCTAT
CAATATACATTCCTAGAGAATTAACTAATTGAAGCAGTGAAGTAATCAATTAGAAATGAA
TTATATGCAAATGCGTCATTTTTATGTGAGAGACTTTTTGCCGAAGTGAAAAATGAAGAT
GTTAAATTACTCCTGGCTGAGTGCTACCTCGGAGAAGGAAAAGCTTATAAAGCTTATGAA
GTGTTGAAAAATTCAATAAATAATGCAAATAGGTATAAGTTCGCACTGACTTGCTTCAAA
TTAAACAAACTTCAAGAAGCTGAGAAAACTCTCTTAAACAGAAAATCATCGATGCCATTA
TAACAGCAAGATCAAAACTCTCTATTAAATTAGGTACCGAATGGAGCTGCTGGACTTTTT
CTACTAGGTCAGATCTGCGAGAGATAAATTAAGCGAAAAGAAGCAGTTGATTTTTACTAG
AAAGCTCTGCAGCAAGATCCAACTCTATGGTGTGCATTCGAGAGGCTTTGCAAACTATAA
ATGAATATCGAACCAAGCAGATATTTCCACGAGAACCACCCTAACATGTAAAAAATGAAT
CAAATAATAAAGGAGTACATGATCTAGTAACAACAATAAATCCTGAACTCTTAGAACACT
CAGACTTAAATAGTGATTAATAATCATGGCATTCAGCAATCACCCAGTCATTCATCGAGT
CATTTGAATATCTAATCCTCTTCTCAATAATAATTCAATTTGTAGTTTAACGCTAAGTCT
CCTTTTATCACTCAGAAATCTCCATCAAACTAGGAAATGAAGGAGAATCAGCTCTCTGCG
AGCAAGAAACCCCTAATAACAGGGGAAGACTTAAACAATTCTAGTTTGATTTGCAACGAC
GATGACAGTTCCTTTTAAAATGAACTGAAAACCCCAACTGGGCAGTCAAGCGGTCAGTAT
ATCACACCTACTAGCAACATGAACTAGGTTCCTACTAAAAAATTGGGTTAGAATGCACCA
GCTCAAACTAATCACTAGTCAAGAATTGGTAATGCAGGAAATAACAATAATTCATTGATA
AATGGGAGTGGAATGGGGTAAGTCGGTGCGGCTACAAGCAGTCAATTAAACTATCAAATT
GACAACGTTGAAGCCACCTAGTCAGTAGGTGGAGGCACGAACATTTTTGCGAACCCAAAT
AACTTGATAAATAACAATGCCAATAACAATATCAACACATCGACCATATCTTCTGGTAAT
AGTGATCCAATCATTAAGCCATTCACAATAAGCACACCAAACTTGAACAACATGAATATG
CCTTCATCAGGAACTGGCAGCATCGGTATTCCATAGTAATTTCTTAATCAAATGTCAAAC
ACACCCATTTCTTCCAGTAATGGTACATAGAACTAGGCTGTATCAAGCTTTGATGCTAAT
TAAATGATGCAATAGTCTGATGATAGAATGAAGACAAGCAGTTTCCTTGCAAACACCACA
TCAATCCAGAAAAACAAGAAAAACATCATGCAACAACAATAACAGCTTGGACAGATGCTA
CAAACACCCCAATAAACCATGAACCTACTAAATCTTCCACCAACCTCATCGCAATCCCAA
CCCAACCTATACAATCTCCAGGCACTTCTTCAATCAACTCAATCAGTGGAGATAACAGAT
TTGACATCACTTTTGAGAGTAATTGGACACGCCTATCAACAACTATGTTTATACAGATGC
CAAGAAAGTGTCAAGATATTCGGTAAATTATCAAAGAAACAGTACACTACTGGATGGGTT
CTTGCTCAAGTTGGAAAGTGCTACTTTGAAATGAGTAAGTACACTGAAGCTGAGAAATTC
TACAAGAAAGTATTAAATGTAGAGCCATATAGATTAGAGGGATTGGAATATTACTCTACC
TGCTTATGGCATCTAAGAAAGCAAGTAGATTTGTGCTATCTATCTAATCATGCTTTGGAG
AAATCTTTATTTGCACCAGAGACTTGGTGTGTAGTAGGAAATTGCTACAGTCTGCAAAAA
GAACATGAAACTGCTCTTAAGTTCTTCAGCAGAGCAATTCAACTGAATGGAAACTTCGCA
TATGCTCATACACTTTCAGGCCACGAGTACGTTTCTAATGAGGACTTTGATCAAGCCAAG
AAATGCTATCAGAAAGCACTCACTGTGGATGAACGCCACTACAACGCATGGTGGGGTCTT
GGAAATATCTGTCTGAAGCAGGAGAAATTTGATCAGGCTGCCTAGTTATTCACAAGTGCC
GTTTAGATCAATTAGAGATCATCAATCCTGTTTACATATCTGGGCATGACTAAACATAAT
TGCGCTCAACCAGGTGAAGCATTGCAGTATTTCGAGAAGAGTGAGCAAGTAGACCCAACA
AACTCCCTGAATAAATTCCAAAAAGCCAACGTGCTGATTTCCCTCGACAGAAACGATGAA
GCCCTGTAAGTTCTGCTTGAATTACTGAAGAACTGCCCCAGAGAGGCACCCATTCATGTG
GTCATTGGCAGATTATACAGGAAAATGGGCAATATAGAGGAGGCACTTAAGTACTTCACC
AAGGCACTTGACTTAGATCCAAAGGATACCAACATGGTCAAGAGTTTAATTGACAAGATT
CATTCTTAAGCAGGACCAAATGGCGCACTGGGAGGCAACGGGATGAACGGCGGAGGAGAC
TTAAATGACGATGGAGATATCCAAATTCTCTGA


>Contig534.1.g132(protein)
MLIQLPQNFQANPGSSAFLTKRNAPDLQTETSQVTSQFGYQYTFLENQLIEAVKQSIRNE
LYANASFLCERLFAEVKNEDVKLLLAECYLGEGKAYKAYEVLKNSINNANRYKFALTCFK
LNKLQEAEKTLLNRKSSMPLQQQDQNSLLNQVPNGAAGLFLLGQICERQIKRKEAVDFYQ
KALQQDPTLWCAFERLCKLQMNIEPSRYFHENHPNMQKMNQIIKEYMIQQQQQILNSQNT
QTQIVINNHGIQQSPSHSSSHLNIQSSSQQQFNLQFNAKSPFITQKSPSNQEMKENQLSA
SKKPLITGEDLNNSSLICNDDDSSFQNELKTPTGQSSGQYITPTSNMNQVPTKKLGQNAP
AQTNHQSRIGNAGNNNNSLINGSGMGQVGAATSSQLNYQIDNVEATQSVGGGTNIFANPN
NLINNNANNNINTSTISSGNSDPIIKPFTISTPNLNNMNMPSSGTGSIGIPQQFLNQMSN
TPISSSNGTQNQAVSSFDANQMMQQSDDRMKTSSFLANTTSIQKNKKNIMQQQQQLGQML
QTPQQTMNLLNLPPTSSQSQPNLYNLQALLQSTQSVEITDLTSLLRVIGHAYQQLCLYRC
QESVKIFGKLSKKQYTTGWVLAQVGKCYFEMSKYTEAEKFYKKVLNVEPYRLEGLEYYST
CLWHLRKQVDLCYLSNHALEKSLFAPETWCVVGNCYSLQKEHETALKFFSRAIQLNGNFA
YAHTLSGHEYVSNEDFDQAKKCYQKALTVDERHYNAWWGLGNICLKQEKFDQAAQLFTSA
VQINQRSSILFTYLGMTKHNCAQPGEALQYFEKSEQVDPTNSLNKFQKANVLISLDRNDE
ALQVLLELLKNCPREAPIHVVIGRLYRKMGNIEEALKYFTKALDLDPKDTNMVKSLIDKI
HSQAGPNGALGGNGMNGGGDLNDDGDIQIL