Identifiers and Description

Gene Model Identifier

Contig5208.0.g47

Standard Name

None

Aliases

Contig5208_0_g47

Description

ATP synthase (C/AC39) subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004334703.000425225396195e-97vacuolar ATP synthase
SGDYLR447C1.0000633497921574e-36VMA6 SGDID:S000004439, Chr XII
from 1027893-1026856, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5208.0.g47(coding)
ATGATTAGCTTTAACGCTGATGACGGCTACCCAGAAGCCATCATTAGATCACTCAGAAAG
GGATTCTTGAGAGAAGAAACCTACAATCAGTTGAAGGCTTGCAGCAATCTCAATGAATTC
AAACTTGTCCTTGAAGACACCGACTATGGTCCATACATCGTTAATGAGCCAAACCCAATT
GAAATTGTCGTTCTCAAGAAGAGATGCAAGGAAAAGTTAATGAGTGAAATCCAACACTTG
ATTGGTCAGACAACTTAACCACTAAACGGTTTCCTCTAAATGATGCTTCATGGTTATCAA
ATTGAAAACGTCGTCGGAGTTATTGAGGGAGTTAAAAATGATCAGCCACTTGAACTACTT
TTGAAAGGTCTTGACCCACTCGGTTATTTCCCAGAGTTGAAAAATATCAGAACTGTAGAG
GGTGACGATTATGCTACTCTCTATCAACAAGTTCTTGTTGATCTCCCCATCGGAAACTAC
TTCAGAAAATTCTTGGAAATCTGTATTGGTTCAATCGGTAACGATGGCGCCATAAAGAAG
GATGCCAGATTCATCTCAGATCTGATGAAGGACTACAAGGCCGAAAAAATTAAGAACATG
CTAAAGAAGATTTGGATCGGAGAATTCCACAAATACAGCATGCAATTGCCAGACGTCAGC
AGACAAACAATGGACGACCTCCTCAAGTTTGAGTCAGACTGCATGACAATCCAAATTATC
TTCAATTCCATTGATATCAAGGGTCTTTCTGATGCCAGAGGCAGAGAAGGAGAGAGAAGA
AAGTATATCAATAATCTCGGTTATCTTTACCCAGACAGAGATAGAGAATTAACTGAAGCC
GATAGCTTTGAAAAGCTCAAGGATGCCTGCAAAGGTTTTGAGTATGAAAGAATGCTCTAA
CAAGTTTCAGATGTACCATCAAGAGACAAGTAAAGTGATTTTGGAGGTGCTAAGGATGGT
GGTTCAAGCTACAGCTCAAACATGTCAATCGATGATGTTATGTTCATTGAAAAATCAAAG
AGATACTCAATGGCTTTCGAGAATCAGTTCCATTACGGAGTCTTCTACGCCTATCTTAAA
CTCAGAGAGATGGAAATCAAGAATATTGTTTGGCTCGCAGAGTTGGTCTCAATCGGTGTT
CCAAGATAAATGCCAGGCTGGTCCAAGTTCGTTGTTCCCTTCAAGTATCACAAAGAAGAG
GTCCAAGGCAACTGA


>Contig5208.0.g47(protein)
MISFNADDGYPEAIIRSLRKGFLREETYNQLKACSNLNEFKLVLEDTDYGPYIVNEPNPI
EIVVLKKRCKEKLMSEIQHLIGQTTQPLNGFLQMMLHGYQIENVVGVIEGVKNDQPLELL
LKGLDPLGYFPELKNIRTVEGDDYATLYQQVLVDLPIGNYFRKFLEICIGSIGNDGAIKK
DARFISDLMKDYKAEKIKNMLKKIWIGEFHKYSMQLPDVSRQTMDDLLKFESDCMTIQII
FNSIDIKGLSDARGREGERRKYINNLGYLYPDRDRELTEADSFEKLKDACKGFEYERMLQ
QVSDVPSRDKQSDFGGAKDGGSSYSSNMSIDDVMFIEKSKRYSMAFENQFHYGVFYAYLK
LREMEIKNIVWLAELVSIGVPRQMPGWSKFVVPFKYHKEEVQGN