Identifiers and Description

Gene Model Identifier

Contig5123.0.g61

Standard Name

None

Aliases

Contig5123_0_g61

Description

TCP-1/cpn60 chaperonin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000370509.997093137033517e-262TCP-1/cpn60 chaperonin family
protein
SGDYDL143W9.997093137033517e-262CCT4 SGDID:S000002302, Chr IV
from 199996-201582, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5123.0.g61(coding)
ATGGACGGTAGTGGCGCTAAGTATTTACAATCAAAAGACATTGGTGGAAAGATGGACTCA
GAGAAGTCTAAGGATATTCGTTCTACTAACATTATGGCAGCAAGAGCAGTCTCTGATGTC
GTGAGAACTTCACTCGGACCAAGAGGTATGGACAAGATGATTCAAGATGGAAAGGGTCAC
GTGCTCATTACAAACGATGGTGCAACCATTCTCAAGCAGATGGAGGTCATTCACCCTACC
GCCAGAATGCTCGTCGAAATTTCAAAAGCTCAAGATATTGAGGCAGGAGATGGTACCACA
TCAGTTGTCGTTATTGCTGGTGCTCTTTTGAGAGCTTGCCAAGATTTAATCGAAAAGGGC
ATTCACCCATCAGCCATTTCAGAGGGCTTCGCCGTCGCTTTGAACAAAGCTGTAGAAATT
ATTGATGGCATGGGTCAACCAGTCGACCTCAACAACAGAGATCAACTCATCCAAAACGCT
GTCACCTCACTCTCAAGTAAGGTCGTTTCACAACACTCCGACTTGCTCGCCCCAATGGCA
GTTGATGCAGTCCTTAGAATTATTGAGAAAACTGACACCAATGTAGATCTTAGAGATATC
AATGTATCCAAGAAATTAGGTGGTACTGTTGATGATTCAGAGCTCATCGATGGCTTGGTC
TTCGTTGACAAGAAGGTCTCTCACTTCGCTGGTGGCCCCTCAAAGATCACCAACGCCAAG
ATTGGTCTCATCCAATTCTGCCTCTCAGCCCCAAAGACTGACATGGAAAACAACGTTGTC
GTTCATGATTACACTGCTATGGACAGAATCTTGAAGGAGGAGCGTAAATATATCTTAGAT
CTCGTTAAGAAGGTTTCAGCTTCCGGTTGCAACGTTCTTCTCATCCAAAAGAGTGTCTTG
AGAGATGCCGTAAATGAACTCGCTTTACATTTCCTTGCAAAGAAGAACATTATGGTTATT
AAGGATATTGACAGAGATCAAGTCGATTTCATCGCAAAGACCATCATGGCCACCCCAGTC
GCTCACATCGACCACTTCACAAGCGACAAGCTCGGAGTAGCCAACCTCGTCGAAGAAGTT
AACGCTGGAGGAGAGAGAAAGATCGTTAAAGTCACTGGATGCCCCAACTAAAACAAAACT
GTTTCAATCTTATTGAGAGGTTCCAACTAACTCGTCCTTGATGAAGCCGAGAGATCACTC
CATGATGCCCTTTGCGTTGTTAGAGCTTTAGTTAAGAAGAGATCATTGGTGCCAGGTGGT
GCTGCCGTTGAGATGGAAGTTGCTCAAAAGCTTCAAGCTCATTCAAGAGAGATCTTCGGT
ACTGATTCATATTGCGTTAGATTATACGGAGAAGCTCTTGAGCTGATCCCATATACTCTT
GCTGAAAACGCAGGAATGGACCCCATTAACTTCGTCACTGAATTGAGAAACAGACATATT
AACGGTGAAAAGAACTGCGGAATTAATGTTAGAAAGAATACTATTATGAACATGCTCGAT
GAGAACGTTGTGCAACCCTCTTTGGTATCAATCAGTGCCTTCACTCTTGCCACTGAATGC
GTAAGAATGATCCTTAAAATTGACGATATCGTCCTCTCAAGATGA


>Contig5123.0.g61(protein)
MDGSGAKYLQSKDIGGKMDSEKSKDIRSTNIMAARAVSDVVRTSLGPRGMDKMIQDGKGH
VLITNDGATILKQMEVIHPTARMLVEISKAQDIEAGDGTTSVVVIAGALLRACQDLIEKG
IHPSAISEGFAVALNKAVEIIDGMGQPVDLNNRDQLIQNAVTSLSSKVVSQHSDLLAPMA
VDAVLRIIEKTDTNVDLRDINVSKKLGGTVDDSELIDGLVFVDKKVSHFAGGPSKITNAK
IGLIQFCLSAPKTDMENNVVVHDYTAMDRILKEERKYILDLVKKVSASGCNVLLIQKSVL
RDAVNELALHFLAKKNIMVIKDIDRDQVDFIAKTIMATPVAHIDHFTSDKLGVANLVEEV
NAGGERKIVKVTGCPNQNKTVSILLRGSNQLVLDEAERSLHDALCVVRALVKKRSLVPGG
AAVEMEVAQKLQAHSREIFGTDSYCVRLYGEALELIPYTLAENAGMDPINFVTELRNRHI
NGEKNCGINVRKNTIMNMLDENVVQPSLVSISAFTLATECVRMILKIDDIVLSR