Identifiers and Description

Gene Model Identifier

Contig5080.0.g13

Standard Name

None

Aliases

Contig5080_0_g13

Description

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00903 ) Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
  • ( pfam13669 ) Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
  • ( pfam12681 ) Glyoxalase-like domain
  • ( pfam13468 ) Glyoxalase-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006782602.000147820282363e-1734-hydroxyphenylpyruvate dioxyg
enase family pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5080.0.g13(coding)
ATGGTAGATTACGTTAAACCCACAGAAAGACCTTCAATCGGTACATTCTACGCTTTTGAT
CACGTTAAGTTCCACGTTGGAAATGCTAAGCAAGCAGCTTCATATTACACCACCAGATTC
GGATTTGAATACGTGGCTTATCAGGGACTTGAGACTGGTCACAGAGACTACTGCACTCAT
GTCGTTAGAAATGGAAAGATTTTGTTTGCTTTTACCTCACCTTTGAACCCAGGCGACAAA
GATTTCGCACTTGAGCTTGAAAAACATGGAGATGGAGTAAAAGACGTGGCTTTCCATGTT
GATGATGCTGCAGGCATTTACACCAAGGCTGTCGAAAGAGGTGCTAAATCTGTTAGACCC
CCTCAAACATTAGAAGACGAGAATGGAAAAGCTATCGTTGCCAGTGTTTAAACATATGGA
GATACCGTACATACCTTTGTTTAGAGAGACAATTACACTGGTCCTTTCTTGCCAGGCTTC
AGAGCTCATCATTATAAGGAAAAGTTTAATAGTCTTGTTCCTATCCCTGAGCTTGACTTT
ATCGATCATTGTGTTGGTAACCAACCAGACATGGAGATGGAACCAGTTGCTTAATGGTAT
GAGAAGATGTTGGACTTCCACAGATTCTGGTCAGTCGATGATTCTATGATCCACACCGAA
TTCTCTTCATTAAGATCAATTGTGATGGCTGATTTTGACGAAGTAATAAAGATGCCTATT
AATGAGCCAGCTGCTGGAAAGAGAAAATCTCAAATCCAAGAATATGTTGACTATTATTCA
GGAGCAGGAGTTTAACACATTGCCCTTAGAACAAACGATATATTGACAACTGTTTAAAGA
ATGGCTGACAGAGGAGTTGAGTTCTTGCAAGTTCCAGACACTTATTATGAAAACTTAAGA
AAAGGTATCTAAAATGCTGGAATTGAAGTTGCCGAAGATATTGATACCATTCAAAAGCTT
AAGATTCTAGTGGACTATGATGATAAGGGTTATCTCTTATAAATCTTCACTAAACCAGTC
GAGGATAGACCAACCCTCTTCCTTGAAATTATTCAAAGACACGGTCATCAAGGTTTCGGA
GCTGGCAACTTCAAGAGTCTTTTTGAAGCAATCGAAGCTGAGCAAGCATTAAGAGGAAAC
CTTTGA


>Contig5080.0.g13(protein)
MVDYVKPTERPSIGTFYAFDHVKFHVGNAKQAASYYTTRFGFEYVAYQGLETGHRDYCTH
VVRNGKILFAFTSPLNPGDKDFALELEKHGDGVKDVAFHVDDAAGIYTKAVERGAKSVRP
PQTLEDENGKAIVASVQTYGDTVHTFVQRDNYTGPFLPGFRAHHYKEKFNSLVPIPELDF
IDHCVGNQPDMEMEPVAQWYEKMLDFHRFWSVDDSMIHTEFSSLRSIVMADFDEVIKMPI
NEPAAGKRKSQIQEYVDYYSGAGVQHIALRTNDILTTVQRMADRGVEFLQVPDTYYENLR
KGIQNAGIEVAEDIDTIQKLKILVDYDDKGYLLQIFTKPVEDRPTLFLEIIQRHGHQGFG
AGNFKSLFEAIEAEQALRGNL