Identifiers and Description

Gene Model Identifier

Contig5064.0.g75

Standard Name

None

Aliases

Contig5064_0_g75

Description

DJ-1/PfpI family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005265901.0003081162615753e-33DJ-1 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5064.0.g75(coding)
ATGAATATTGCAAGTTCACACGCAGCTCACTCTCATCACATGATTAAGCGGGCACTTCTT
GCTGTAGCAAATGGTTCAGAAGATGTGGAGACAGTCACTGTAATTGATATATTGAGAAGA
GGAGGAATCCCTCTCACTGTAGCCAAAGTTTTTGAGAGCTCAGGTTCATAGGCTCATGGA
GAGTCAGAAATGTAACAAGTTGCTGATAAAAAATTGACTGATGTTTTGAACGATAATTTC
GACATGATTATCCTACCTGGTGGTGGCAAGGGTGCTGATACTTTCTCTAAGAGCAAAGAT
TTAAAATTGATGCTTATGAGATAACATGAATAAAACAAGTTAATTGCAGCAATATGTGCG
TCCCCTGCTTAGGTCTTGGTACCTTTTGGAATCCTTAAGAGCTAGAATGCAACTTGCTAC
CCTTCAATGCAAAACTAACTCAAGAATCAAAAGCATATAAATGATTTAGTTGTCATGGAT
CATAACTTAATCACAAGTCAAGGGCCAGGTACAGCTGCTCAATTTGCATTTAAATGCTTG
GAAATGTTGAAAGACAGAAAAGAGGTTGATAAAGTTTCAAAGGCGATGCTAATAGACTAT
AACGTCTGA


>Contig5064.0.g75(protein)
MNIASSHAAHSHHMIKRALLAVANGSEDVETVTVIDILRRGGIPLTVAKVFESSGSQAHG
ESEMQQVADKKLTDVLNDNFDMIILPGGGKGADTFSKSKDLKLMLMRQHEQNKLIAAICA
SPAQVLVPFGILKSQNATCYPSMQNQLKNQKHINDLVVMDHNLITSQGPGTAAQFAFKCL
EMLKDRKEVDKVSKAMLIDYNV