Identifiers and Description

Gene Model Identifier

Contig4955.0.0.g74

Standard Name

None

Aliases

Contig4955_0_0_g74

Description

BNR/Asp-box repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004673909.997093137033517e-262BNR/Asp-box repeat family prot
ein
SGDYBL017C1.000499495426459e-47PEP1 SGDID:S000000113, Chr II
from 191583-186844, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4955.0.0.g74(coding)
ATGAGCTATTGCGGTAGTGCACGAACTCCTCGAAATTCAGCAGCTAAAACATATTCTAAA
ACGAAATTCTTCTTACCCATACTGGGCTTAACTTACTTTTTGACTGTTTAAAGCCAAGTT
CGAGCTGCCAACACCGATTAAGTTGATTTTACAAGGTATGAACTCGATTCAGGAGTGAAA
GATATCATGTGGTGTGGCTAATAAGATGAAATTATCCTCATATTGTCTGAAAATGGCAGC
GTTTACCGATCTAGAGATAAAGGTTCAAGTTGGAAAAAGTTACAGGCAGCAATATCTCTC
AGTGGCTAGAAAGTTGCCGATGATGATTAAGAGATAGGCAAAGTAACTGATTTGATGTAG
AGTCCTACTGACGATAGCATGGTCGTATTTTTAGGAAGTCATGGAATAAATTGGGTGACT
GAAGATTGTGGAGCAAGTGTAAGAGGATTGAACAGTGGTAAAAAGATACACGAGTTCTAG
TTCCATCCTACCATGAAATACTGGGCACTAGCTGCTTCATGGACTGACTGCTAAGAGTTT
GGTGATGATCCATGCAAGATTTATAAGGAACTTTATTTCACTTAAGATATGGGATAATCT
TGGAAATTCTTGAAAGAATACGTTTATGATTTTGCTTGGGCCTATTCCAAAACTGCAGAA
GATTAAAAGATTGCCAATTTACCAAAGGAAAGAATCTTTATTACTCACGACCCTAAAGCT
ACAGGACATCAAAATCAGGATAAAAAATTGTGGTCTCCACAAGTTAACCTTTACTACTCT
GATGATTTCTTCAAAAATCAAAAGAAAATGGCATTAAACAATGGAAATAGCATAATAAAA
ACTGAGCATTATATGTTTATTGCAAGAGCTACTCAGAAAGAGTGGGTTGAAATATTTGTT
TCTACTTATCAGCAAGGTTTCCTAGATTTTGAAAGAGCTAAGTTACCAACTGATGCAATA
TAATCAAAAACCTTCACTGTAATGGATACCTCGGAATAAACTGTTTTCCTTCATGTTTAA
AATCATGGCCCAACTACCCCTCTTGGAAATATTTTCATTTCTGATGGTTATGGTAAAAAC
TTCTCCCTTTCTCTGGAAAATGTCATTAGAGGTACTGAATTAGTAGACTTTGAGAAGATT
AACTCTTTAGAAGGTGTATTTATTGCAAATAGATTTGATACTGAGCACACCCACAACTCT
GAGTTCTCGAAATCATTCAAAAATTAAAAAGGACTTACTCAAAAAGATGAAATTTCTGAG
TCAGACATTTTGTAAGAAAAGATGCAAAAATTGAGACGCAGTCAATCAAACACAAATTCA
AACATTAACAAGAAGCAATAGAAAACTAAAGAATCTGTGATGAAAGAAGGTGATGAATTT
GAAATGAAAGACTTGCAATCCAATATTAGAACTTTCGTAACTCATAATAAAGGTGGTAGA
TGGGACTTAATTAGAGCACCAACAACTGATTCAGAGGGCAACAAAATTGATTGCTACCTT
GAAGAAGGATGCTCATTAAACATCGAAATTTACTCTTCAAATGGCAATTTTGCACCTCCC
TACTCTCAAGAAAGCAGCATTGGTATAATTATGGCTATAGGTAGCCCTGGTTATGAACTC
ACTAAAAAGGTCAATGGCAATGCAAATACTTATCTTTCAAGAGATGGAGGCCTTAACTTT
ATGGAAGTAAAGAAAGGTTCTTACATTTATGAAGTAGGTGATCACGGTGGCCTAATTGTT
ATGGCAAAGAATAACGAGTAAACAAAAGAAGTTATTTACAGTTATAATGAGGGATTAACT
TGGCACAGCCTTGAAATTTCTGACACTCCATTTATGGTCACTAATATCATCATTGAACCA
ATGAGTGTCTCACAGGAATTCGTAGTCTATGGATATTAATATCTTCGAGCAAATGACAAG
CCCAAGGGCATGATTTTCACTCTTGACTTTAAGTCACTCCACGAACCTCAATGCAAGGGT
GCTGATAGACCAGGCGACACTGATTCTGACTACGAGCTATGGACTCCATTCGATGGCAGA
CACGGAGAAATGAAATGTTTCCTTGGTCAGTAGGTTACATACATCAGAAGAAAGCGTGAA
GCTGAGTGCTTCAATGGAGAGGAACTTGAGAGAAAAATCTTAAGATCTTACTGCCAGTGC
ACTGAAATTGATTATGAATGCGATTACGGCTTCACTAAAGATCCCAATAACAATAATCAA
TGTATCAAGGAAAATTGGCTCACTCACCCATCAGATAAAGCCAATGAGTTGAGTGCTTCA
TAACAAGCAATGTGCTCATAATACGGTTACTATACTGTTTCACAGGGCTACCGTAAAGTG
CCTGGCAATAAATGCGTTGGTGGTCTCGATTTAAATCCAATCGTCTACTCCTGCTCAGCA
GTATCATTTATCAATTTTATACTTCGGATGGCCCCTAGTTGA


>Contig4955.0.0.g74(protein)
MSYCGSARTPRNSAAKTYSKTKFFLPILGLTYFLTVQSQVRAANTDQVDFTRYELDSGVK
DIMWCGQQDEIILILSENGSVYRSRDKGSSWKKLQAAISLSGQKVADDDQEIGKVTDLMQ
SPTDDSMVVFLGSHGINWVTEDCGASVRGLNSGKKIHEFQFHPTMKYWALAASWTDCQEF
GDDPCKIYKELYFTQDMGQSWKFLKEYVYDFAWAYSKTAEDQKIANLPKERIFITHDPKA
TGHQNQDKKLWSPQVNLYYSDDFFKNQKKMALNNGNSIIKTEHYMFIARATQKEWVEIFV
STYQQGFLDFERAKLPTDAIQSKTFTVMDTSEQTVFLHVQNHGPTTPLGNIFISDGYGKN
FSLSLENVIRGTELVDFEKINSLEGVFIANRFDTEHTHNSEFSKSFKNQKGLTQKDEISE
SDILQEKMQKLRRSQSNTNSNINKKQQKTKESVMKEGDEFEMKDLQSNIRTFVTHNKGGR
WDLIRAPTTDSEGNKIDCYLEEGCSLNIEIYSSNGNFAPPYSQESSIGIIMAIGSPGYEL
TKKVNGNANTYLSRDGGLNFMEVKKGSYIYEVGDHGGLIVMAKNNEQTKEVIYSYNEGLT
WHSLEISDTPFMVTNIIIEPMSVSQEFVVYGYQYLRANDKPKGMIFTLDFKSLHEPQCKG
ADRPGDTDSDYELWTPFDGRHGEMKCFLGQQVTYIRRKREAECFNGEELERKILRSYCQC
TEIDYECDYGFTKDPNNNNQCIKENWLTHPSDKANELSASQQAMCSQYGYYTVSQGYRKV
PGNKCVGGLDLNPIVYSCSAVSFINFILRMAPS