Identifiers and Description

Gene Model Identifier

Contig4825.0.g10

Standard Name

None

Aliases

Contig4825_0_g10

Description

Uracil DNA glycosylase superfamily

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03167 ) Uracil DNA glycosylase superfamily
  • ( pfam10310 ) Protein of unknown function (DUF2413)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007942502.000299424410363e-74uracil-DNA glycosylase family
protein
SGDYML021C2.000364041471746e-45UNG1 SGDID:S000004483, Chr XII
I from 230813-229734, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4825.0.g10(coding)
ATGAGCGCCAGTCAATCCAACTTAATGAAATTCTTCTCTTCAGTAAACAAGAAACCTGAA
TAACAATCTATCTCACCTTAGAAAGAGCCAGTTACTCAAGCTTCAGAAAGTAAAAAGAGA
AAACTCGATGAAATAAGCAATATTGAGGAGTAGCAGTAATCTCAAGTCTCCCAGAAATCT
GCAAAATAAACACCTGTAGCTAAAAAGAGAGTATGTTTCTTCAAAATTTATAATTATATT
TAGCAATTGAACTCTGACGCCAAGGTAAAGTCATAATCGAAATCAAAGACTGCTGCTAAG
TCTGAAGAAGAAAAAAAACCCATTAAAGAAGTAGAGGAAGAAAAGTAGCATTCTTCTGTT
CAAACTGCATCCTCCACTACTTCAACAATTACCAATAAAACTTTGAATGGTGAAAATAAG
CAGCCAGCTTAGAAGCCAGGACAAACTGTCCCTTAGATTGACTCATAGTATTGTTTGGAT
GGATATGATAGATTCATAGCTGAACTTGGAGATTGGAATGAGCCTTTAAAGCCATATCTA
TAGGGCACTTAATTCAAACAACTTTTCAAATTCGTTTAAGGAGAATATTCAAGTCAAACT
ATCTATCCACCAAGAGAGTTAATCTTCAATGCCTTCAAGCATGTTCATTGGGATAATTTG
AAAGTAGTTATAGTTGGCTAAGATCCCTACATTAATCAAAATGAAGCTATGGGTTTATGT
TTTTCAATTCCTAAAGGAACCAAAGTACCTCCTAGTTTAAGAAATATTTACAAAGCATTG
GAAAATGACTCTAAAATTGACTTCAAAATGCCAAATCCAATTCACGGAGATCTAACAAAA
TGGGCTTCTCAAGGCATACTCTTACTTAATGCAGTCATGACTGTGAGAAAGGGAATTTCA
AACTCACATGCCAAGAAGGGATGGGAGCAGTTCACTGACTAAGTCGTTAACGTCATTAAT
TAGAAGAAAGAGGGAGTTGTCTTCATGTTATGGGGAAAAAGTGCTTAAGAAAAGGCTAAA
AATGTTAACACTAAGAAGCATCTGGTTTTGAAATTCGTTCATCCATCACCATTAGCAGGA
GCAGGATTTCCACAATGCCCACATTTCTCACAAACTAATGAATATTTGACTTAACAAAGC
AAATCCGAAATTGATTGGCAAGTGTGA


>Contig4825.0.g10(protein)
MSASQSNLMKFFSSVNKKPEQQSISPQKEPVTQASESKKRKLDEISNIEEQQQSQVSQKS
AKQTPVAKKRVCFFKIYNYIQQLNSDAKVKSQSKSKTAAKSEEEKKPIKEVEEEKQHSSV
QTASSTTSTITNKTLNGENKQPAQKPGQTVPQIDSQYCLDGYDRFIAELGDWNEPLKPYL
QGTQFKQLFKFVQGEYSSQTIYPPRELIFNAFKHVHWDNLKVVIVGQDPYINQNEAMGLC
FSIPKGTKVPPSLRNIYKALENDSKIDFKMPNPIHGDLTKWASQGILLLNAVMTVRKGIS
NSHAKKGWEQFTDQVVNVINQKKEGVVFMLWGKSAQEKAKNVNTKKHLVLKFVHPSPLAG
AGFPQCPHFSQTNEYLTQQSKSEIDWQV