Identifiers and Description

Gene Model Identifier

Contig4754.0.g7

Standard Name

None

Aliases

Contig4754_0_g7

Description

UvrD/REP helicase N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJL092W1.999002769139511e-37SRS2 SGDID:S000003628, Chr X f
rom 257423-260947, Genome...
T. thermophilaTTHERM_008294401.000361553249356e-16UvrD/REP helicase family prote
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4754.0.g7(coding)
ATGGTTAGGAAGTCTAAAGCAAAAGCTGAAAAGAAAAGAGAATAAAAATTGCATGAAAAG
TAGATTAAAAAGAATATTAAAAGACAAGTTTAAGAAGATTTTGACGAGCATGATCTCAAA
AAGAAAGAATTAACTTTGAATCCTAAGTAATTAGAGGCCATTTAATACGATAAAAGTCCT
CTACTTATCTTAGCTGGAGTGGGTACCGGGAAAACTTAAACTCTGATGAGTAAATATGCA
AGTTTAATATAGCAAGGAATACCACCAGAAAACATTTTAGCTCTAACTTTTACAAAAAAG
GCAGCTAAAGAAATGAGAAAAAGAGCTTAACTACTCACTGAAGACCCTTTGATAAATTCT
TGGATTGGCACTTTTCACTCTCTATCTGGAAAGATGCTAAGAATGAACGACTGGCATGAT
AAAGTTGGCCTTACAAGCAAGTTTAACATAATAGATGAATTGGAGCAGTCAGAAATTCTA
AATGAGATATATTTGAAACAACCATTTGTTAAGTAATTAATCTTGAGACATATTTAGGAA
GAATTGCATAAGCAAGATAAATTTTACATTCCTAAAATCAACAACTTTAGGATACTATCT
TCAATCGATAAGTTTAAGAATTCTTGTATAAGTCATAAAGGGAACTTAAATTATTACAAA
GAGTTAAAACTTACGAAGTTTGATGAACTGATCTTTATGAATATATATGCTGATTACTAG
AATGCATTATTGGTGAAAGACTCTGCTGATTTTGGGGATTTGCTTCTTTTTGTTCACAAA
CTGATGAAATAAAATTAAACTATTCTTGACACATTGAGAAATAAGTTCAAATACATCTTG
GTAGACGAAGTGCAAGATTTGAACAAACTATAGTAAGAGTGGTTAAAACTGATTGTTGGA
GATAATAAACATCTCACCTGCGTAGGGGATGATGATCAGATGATCTATGGGTTCAGAGGG
GCAGATGGAGACTTCATCCTAAACTTTGAAAAATACTACAAGAAAGCTCATATTATCAGA
CTAGAACAAAACTACAGATCAACTAAAAGTATAATAAACGCGGCAAATAACTTAATTCAG
CATAATAATTATAGAAAAGGCAAAAAACTCTGGACCTAAAATCATTAAGGAAATAATGTT
TAAATTGAGCAGTACGATACCCCAGAGTTGGAGAGAGAATATGTATGCCAAAAAATTATG
GGGCTAATCAATAGTTAATACCAAGACATGAATCATGTTGCAATTTTGACAAGGAAAAAT
GAATAAGCAAGAGAATTTGAATCGGTGTTAGTGTATCACAACATACCCTATAAACTTAGT
AGCACCAAAAAGCCTTTTCTTTAAAAGCTAGAAGTTAAAAAGGCTTATGAATATCTACTA
TTTCTGATTGACCCACATAACGATGAAAACACAGAATAGGTCATACTTACTTTGGAAGGT
ATAGGTAGTGAAACTATAAAACGATTGAGAAACATATAAGATAGTTATAAAATAGGAAAA
AAGGCTTCATTATTTGAGATATGCTAACAAATTATAAAAGGCGATATAACTAACTTCAGA
TCAAGTGAGAAAATAAGATAACAAAAATTAGAAAATACCAGTAAAATTGTTAATAATTCT
GATATTAAAAGTAGAATAAGCGTCGACTTAAACGAAATAGAATAAGAAATTATAGACCTT
GGGCTTTTGAATGATGACATAATTTCAATCTAAGGCATCGATGCAGAAGAAATTAAGGTG
TAAACTCCTTCTTTAAAAGGGAAGAAAATATTAAGCACCAAGAAAATTGAAATAATATAG
AATCTATTTAAGTTAAGAGAAAAGTTTAAAAGTCACGCAGATTCCGAGAATATAGTAATT
TATCTGACAAATTCAAATTTCTTTGAGTACTTGAGAAGTTTATGCGAAAAGAATGGTAAA
GACCCCTATAAAGCAATGAAGAATGTTGAAGCTCTAATTAGTCTATTAGAATAATTAGAA
AGTGTACAATCTTTAATGTGGAGATTTAAAGAAATGAATAAAGAACTCGATAAACACAAT
CAAGAGCAAAGAATTAAGGTCATGACTGTGCATTAGAGTAAAGGCCTCGAATTTGATGAA
GTTTTTCTACCATTCTGGACTCAGGGAAGTATGCCAATTCAAGGAACTTCAGAAGCTGAA
TTTGAAGAAGAAAGAAGAGTGGCTTTTGTTGCAATAACTAGGGCCAGGATCAATGTTCAT
ATTAGCTATCACTCATAAAGCAAATTTAATGATAAAGTATGGAATAAAAGACCTTCATAA
TTTTTGAAGGAACTAAAGAAAAAGCGATGA


>Contig4754.0.g7(protein)
MVRKSKAKAEKKREQKLHEKQIKKNIKRQVQEDFDEHDLKKKELTLNPKQLEAIQYDKSP
LLILAGVGTGKTQTLMSKYASLIQQGIPPENILALTFTKKAAKEMRKRAQLLTEDPLINS
WIGTFHSLSGKMLRMNDWHDKVGLTSKFNIIDELEQSEILNEIYLKQPFVKQLILRHIQE
ELHKQDKFYIPKINNFRILSSIDKFKNSCISHKGNLNYYKELKLTKFDELIFMNIYADYQ
NALLVKDSADFGDLLLFVHKLMKQNQTILDTLRNKFKYILVDEVQDLNKLQQEWLKLIVG
DNKHLTCVGDDDQMIYGFRGADGDFILNFEKYYKKAHIIRLEQNYRSTKSIINAANNLIQ
HNNYRKGKKLWTQNHQGNNVQIEQYDTPELEREYVCQKIMGLINSQYQDMNHVAILTRKN
EQAREFESVLVYHNIPYKLSSTKKPFLQKLEVKKAYEYLLFLIDPHNDENTEQVILTLEG
IGSETIKRLRNIQDSYKIGKKASLFEICQQIIKGDITNFRSSEKIRQQKLENTSKIVNNS
DIKSRISVDLNEIEQEIIDLGLLNDDIISIQGIDAEEIKVQTPSLKGKKILSTKKIEIIQ
NLFKLREKFKSHADSENIVIYLTNSNFFEYLRSLCEKNGKDPYKAMKNVEALISLLEQLE
SVQSLMWRFKEMNKELDKHNQEQRIKVMTVHQSKGLEFDEVFLPFWTQGSMPIQGTSEAE
FEEERRVAFVAITRARINVHISYHSQSKFNDKVWNKRPSQFLKELKKKR