Identifiers and Description

Gene Model Identifier

Contig4658.0.g2

Standard Name

None

Aliases

Contig4658_0_g2

Description

GCC2 and GCC3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA) | GO:0016705

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_014162403.999970367130025e-21GCC2 and GCC3 family protein
SGDYDR356W7.9993595954329e-16SPC110 SGDID:S000002764, Chr I
V from 1186107-1188941, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4658.0.g2(coding)
ATGTATTCTTAGACTAGATCCAAATTTTAAAGTTTGAACATATCAAAATTCAAAGTTTTC
AAGCCACCTCCCCAGGCCATGTCTCTGAAGTTAGCATCGGCTTGTCCCGCTGGTTACGAA
TGTGATGGGTCGGGTGTATAGTTGGCCGCCTGCACTTCAGGATATTACGCTCTTTTAAAT
GATGGAGTATGTACCTAGTGTCCAGCAGGTTCTTATTGTGCAAATAATTATGAATCTCCA
CTTGCTTGTTCAGGCACAGGTACAGAATAGTATTCACCAGCAGGTTCAACAACTTGTTAC
TAATGTCCAGCTGGTAAAGAATGCCCATCAATCAGTGCCACTCCTACTGATTGCAGCTCT
GGTGAATATTCACTTCTCGGAGACACAGGCTGCACTACATGCCCAGCAGGCTCTAAATGT
GCTAGTCTTGACTAATCCCCTGTCAGTTGCAGTAGTGGAGAATATTCAGCAGCTGGTGCC
ACTTCATGTATCACTTGCCAAGCTGGTTATTACTGCGCATCTACAACTTCATCCCCCGTT
TAATGTTCAGGCACTGGATTAGAACAATACGCCTTAGCTGGTTAAACTTCGTGTTCTCAA
TGCCCAGCAGGATACTCCTGTCCAGACATATATTCTATTCCCACTGTTTGTTCATCTGGA
TATTATGCTCTTGCTGGAGATAGATCATGCACATAATGTCCCGCTGGTTCTATGTGCTCA
ACGACCACAGCATCACCAGTTGCTTGTAGCTCAGGAGAATATTCATCAGCTGGTGCCATA
TCTTGTACACAATGCCCAGCAGGTTATAAATGTCCGTCTACTACCTCAAGTCCCTCACAA
TGCTCTGGAACTGGATTAGAACAATACTCTTTAGCAGGTTAAACCTCATGTTCTGAATGC
CCTGCAGGATACTCTTGCCCCGATATATACACAACTCCAGCTGCTTGCTCTAGTGGTCAA
TATTCCCTTGCAGGTGAATTGACTTGCACATCCTGTCCAGCAGGTTCAGAATGCCCATCG
ACTACCGCATCTCCAACAACTTGTTCAACTGGATATTACTCACTTGGTGGAGCTGCTGCC
TGTACTTAATGCCCTGCAGGTTACGAATGTCCATCAGCATCCAGCTCCCCATCTGTGTGC
TCTTCTGGTTATTACTCACTTGATGGCCAATCTTCTTGTACCTAATGTCCAGCAGGCTCT
AAATGTCCAACAACAACCGTAGCTCCCATTGCATGCTTAGGAACAGGTTTAGAACAGTAT
TCTGTAGCCGGATCAACAGTATGTTCTCAATGCCCTGCCGGTTATGAATGCCCCACTACC
TCTTCAGCACCTACTGCTTGTACTACTGGCTACTATTCACTCATTGGTGGTGGCACTTGC
ATCTAATGTCCAGCAGGATCAGAGTGCACATCAACTTCAATTTCACCAGTTGCTTGTTCA
AGTGGTTCTTATTCACTTGCTGGTTAGACGTCTTGCACTACTTGCCCTGCAGGTTCTTAA
TGTCCATCTACATCAACATCACCAGTAGCTTGTTCAAGTGGAGAATATGCATTGTCAGGT
TCAATATCTTGTACCACTTGTTTAGCAGGATATAAATGTCCTTCAACCTCCTCCAGTCCA
ACATAATGTTCAGGTACAGGTTTAGAATAATATTCCTTAGCTGGTTCAACATCATGTTCT
CAATGCCCAGCAGGATCCTCCTGTTCAGATATTTACTCAACTCCAGTGGCTTGCACATCA
GGATACTACTCTCTTGCCGGAGAATCTACATGTACCTAATGCCCTGCTGGTTCTCAATGC
CCAACTACCTCAGCTTCTCCTACTGCTTGCTCATCTGGTCAATATGCATTATCTGGAGCA
ACTTCATGCACACCATGTCCAATTGGTTATGAATGCCCTAATACCAATTAATCCCCAACT
GCTTGTACTTCTGGCTATTATGCATCTAGCACTTTACAAACTGCTTGTACTTAGTGTCCA
GCTGGTTCTTAATGCCCATCCACAACTGTAAACCCTGTTGCATGTACAAGTGGTTAATAT
TCCTTGGCTGGTTATACTACTTGTGAACCTTGCCCAGCAGGATTCAAGTGTCCAACAACA
AGTGTAGCACCCATTCAATGCTCAGGTACAGGTTTAGAATAATATTCTCTATCAGGAGCA
ACTTCATGCTCTCAGTGTTCAGCTGGATTCTCTTGCCCAGACATCTACACAACCCCAATA
GCTTGTTCTTTTGGAACATACTCTCTAGCTGGTGGAGCAACATGTATCTCATGCCCAGCA
GGTTCAGAATGTCCAAGCACCAGTTCTTCTCCTGTTTCATGTAATTCTGGCTATTATTCG
CTTATAGGAGGTGGAACTTGCATTGCTTGTCCAAAAGGAAGTAAATGCCCAAATAATAAT
GAATTGCCAACTACTTGCGAAGATGGGTATTATCAATCTGCAACTGCCCAATCAACTTGT
ATCATATGTTCAGTTGGTAAATAATGCGCAGATAAAACGATTGACCCAGTCGTTTGTTCA
GGCTCCCCAACAGAACAATACTCTCCAGGTGAAGTAATGGCCTGTCAAAAATGTCCAGCT
GGTTATGCCTGTCCAACAGTTTATGTTAAAACAGCTTGTGCAGTTGGCACCTATGCTTTA
GAAGGAGATGCCGTCTGTAACACATGCCCATTTGGCTATGGATGCACAGATCCAGCATCA
TCTCCAGTTGCTTGCACCTCTTCTCAATACTCCCTTCCAGGTATCTCAGAATGTCTACTA
TGTCCACCCGGCTACGAATGCCCAACTACTTTGATGATTCCTTAACTCTGTTAAGAAGGG
TACTACTCAAAATAAGGTGATGGAAAATGTTCCATTTGTCCAGCAGGATACAGTTGTTTA
AAGAGAACAAGTGATCCAGTTGCTTGCTCAAGTGGATACTTTTCTATCCAAGGCTAAGGC
TACTGTGATAAATGTCCAACTGGATACTATTGTCCTACTACTACTCAATCTCCCTTTAAG
TGTCCAGCAGGATCTTACTCACTTTCAGGTTAGTCATCCTGCACAGATTGCCCGGTTGGT
AAATTCTGTCCCGCTACAAACACACCTCAAGCTTACGATTGCCCATCAGGCTACTATGCC
TCAGTAACTAATTAAGTATCTTGTACAGCTTGTCCTGCTGGCTATTCATGTTCAGATCCA
ACAGTCAATCCTGTTCCATGCACAGAAGGTTACTATAGTTTCGGATATGCAGGCACTTGC
ACTCAATGTCCTGCTGGTTTCTATTGTCCCAAAGCAAATGCTTAACCAGTTTTATGTCCA
GCTGGTAAGCAAAGCGCAGCTGGCTAATCTGAATGTCTTGAATGCCCAGATGGAGTAACA
TGTACAAGAAGTGATGGTATTATTCAAGATCCTTGCACATCTGGCCAATACAGAGTTAAT
GATGGAAGGATTGAAATTTGCAGAGATTGTCCTCCAGGACACATGTGCCCAACAATTACT
TCACAACCAATTATTTGTCCAAGTGGTACTTTTGCTAAATTCGCTTAAACATCTTGTACT
GCTTGTGCTGCTGAACACTTCTGCCCCAGTCTGGGAGCTGATGCTTAGGAATAATGCCCA
CCAGGTACCTTCCAACCATTGACTTCAAAAACTTATTGCAATGAATGCCCACCAGGTCAC
TATTGTTCATCAACTCTTGTTGCCTCAGCAACCGCTTGCCCAGCTGGTAAATTCGCTCCC
TATGGAAATCAAACAAGTTGCTTGAGCTGTCCAGCAGGATTCTTCTGTCCAACTGAAGGC
CTTACAGTTCCCATTCAATGTCCAGTTGGCTATTATAGCAGCACAGATGCTGAACAATGC
ACAATGTGTGAAGCAGGGTATGCATGCCCTTCTGGATACTTTTCAGATAGATATTCATGC
GAGAGTGGTTCATTTTCCTACGCCAGCTCAACTTATTGTTTCCAATGTCCAATCGGTAAA
TCATGCTTATTATCTGGTAGTGTTTTGACTGTTTAAAATTGTCCACTAGGCTACTACAGT
GACATGGGTAGCATTGCATGCAGTTAATGCCCAGCTGGGAAGAGTTGTCATACTATGGAT
TCGTTAGGAATTATTGATTGTGAAAGTGGTTGGTATTCACTAATTGGAGAAACAAACTGT
CAACCCTGTCCTGCTGGTTTCATGTGTCCAAACAAGGATGGAACAGGAATAGCATAATGC
AGTGATGGCGAATTTGCTCCAATTGGTTCAAGTAAATGTTTCACATGTCCAAAAGGCAAC
TATTGCCCATATAAACACATCGCATTCATCGAACAATGCCCACCAGGAACATACTCTACT
GGAAATCAAAATATATGCAAGGAATGCCCTGAACACTATGAGTGTCCACATCGTGATTCA
AAAATAGATGTTAAAGACGGTTATTTCAGTCCAAAGGGAACTGGTGTCGCGCTTAGATGT
AGAGCTGGATGGTACTGTAGTATGACATCAACTCCACGTGTTGTTAGACCTTGTGAGCCT
GGATATTACTCAAATACAGGTTCCTCCTCATGTACTGCATGCCCAATTGGATCATCTTGC
TACTTACAAGATGTTTATACCTCATAGGTTACATGCCCAGAAGGTTACTACTAAGATGAA
GCAGGTAAAACCTATTGCAAAAAATGTCTCGATAAAACTTTCAAAACAGACCGTTCAGCT
GAAACTTGCTCTTCTTACACAGATGGTTATGAATTTATTTTTGGAGGTTTTACTTAACAA
AAGCAATGCCCCTATGGTTCTTACAGTACAGGAGCTACAGTTACTGACGAAAGTAAATTA
GTCTGTTAAGATTGTCAAGCTGGTGGTATTTGCACAACAGGTGCAACATCTGATGTAACA
ACTGTATCCTGTTATAGCGGATTCTGGTGTAATCATCTGCAAGGATCAAACGCTTTATAT
GCTATGTTCCCTTGCCCACCAGGCTACAAAGCCACAGGACTCACAAACGCCAAAACTAGA
GATGAAGCTTGCACACAATGTACTGCAGGTGTATACTGCGAAGGTGCAAATACTCCAGAA
TAAACTTGCATCAAAGGTCACTATTGCCCTGCATTTACCACTAGAGCCACCTAATATCCA
TGCCCAGCAGGTACTTACTAAGATCAATTAGGAAAGACAGCAGTTAGTGACTGTATCACA
TGTCAGTCAACATATTACTGTCCATAAGGATCATCCAAGTAAATTCAATGTCCTCCAGGT
ACTATTTGCAACTCAACAGAATTAAGAGAATACCAAATGGTTCCTTGTCCAGCTGGATTC
TACAATCCAAACTTAGGTTAAACTACTTGCGTTTCATGCCCATTAGGTGCTTTCTGTCCG
TCTGGTTCAGCATATCCACAACTTTGCCCACCAGGCACTTACAACGATTAACCTGAATAA
AAACAAAAAACTGATTGCAAGACATGCCCTGATAATTATGTATGCAGTGTGTTTGGACTA
ACTGATTATGATGACATTTCATAGCCAAACATAGAAGCAGGATATCTTTCACCAGCAGGT
GTACAATATGCTCAACAATTGCCATGCCCTCCTGGTACTATTGATAATGACAAGAATCTT
ACAAATATTAATGAATGTGATCTTTGCCCAGCAGGATCAGCTTGTGAACTTGGAACTGCC
TTAACTGCTTATACCAGAAAGATGGTGATATGTGAACCTGGCTATTACTGCCCAACTGGA
ACACTTCATGATAAGTAATATCCATGCCCAGGTGGCACCTATTCAGCAGCCCATGACTTG
ACACTTTCTACTTAATGCAATTAATGCCCAGCTGGTTACTTCTGCCCACCAGGTTCCTAC
AAACCCTTTATTTGTCCAGGTGGATATTTCTGCCTTGCAGGTACTGAAAATTTCCAACAC
AGTCCATGTTCAAATGGAACTTACAGCTATAAGAAGGGGTTAACAAGTGCTATTGAATGT
ACTATTTGCCCCACAGGGCATTTCTGTAGAGAACATAGCACTCAACCTGAAAAATGCCCC
AAGGGTACTTATAACGATGTATAAGGAGCATTTATTGCTGATAACTCAATAGTTTCAAAT
TCAGGCTCAATTAAAACTTGTAAAATATGCAGTGAAGGTTACTATTGCCCAACTGAGGGA
ATGTCAGCTATGATTAAATGTCCAAAGGGAACTTACTCTCCTAGTGGAAGTTATATATGT
CTTGAATGCTAAGAAGGCCATGATTGCTAAACAACTGATGGTATTACTTTCACAGATTAT
AAAGCAAATAAAAATACTCCAAATGGCTACTACAGCGATGGAGTTGTGTAATACATTTGT
CCACCAGGTCATTTCTGCCCCACTGCTACTAAAATATATCATTAATGCCCCTCTGGTACA
TACATGCCAAATTCACTCATAGATTCAGTAAATTATGTAGGAAATTCACAATCCAATCAA
TGCATTAAAACCCCAGCTGGTTACTTCACTTAACTCCGTGCTTCTACTAGTTACAGTGAC
AATATATGTGAATTGGGATATTACTGCCCAGAAGGTTCAAATAATGCCTATGTTAATAGA
TGTCCCAGAGGTTTCTACACAGATGAGTTCTAATCTACCTCTTGTAAAACATGCCCAGCT
GGCTATTATTGTGATGAATACAATATCTATCCAGTCATATGCCCATAAGGATATTATTGC
CCAGCTTAAACTTATGAACCAACACCATGCAGCAAGGGTACTTTTGGATCGTTATTAGGT
AACCAAGCTTCAACAGATTGTTTGAGCTGCCTTCCAGGTTAATACTGTTCCCAAGCAGGA
TTGTCAGCTCCTGATGGTCTCTGTGACCCCGGCTATTTCTGTAAAGGTGGTGCCTACAAA
GCAGACCCCACAGATGGTATCACAGGAGACGTCTGCACTGCTGGAGGATTCTGTGAATAT
GGATCTAAGAGAGTGAAGGAGTGCCCTCCAGGTACCTACAACCCCAACACAAAAGCCAAG
ACTCAAACTGATTGTATTTAATGCTTGCCAGGCTACTACTGCGCAGGTGCTAATCTACCA
CTTCCAACAGCAAAATGCGAGGCAGGTTACTATTGTCCAAGTGGTTCATCAAATTCCAAA
TAATTAACTTCCCCTCCAGGATATTTCTCTCTTGAAGGTGCAGCATCTCCAACTATTTGC
CCTCAAGGCACTTATAATCAGTTTACTTCTAAAAGCGAATGTACTAAGTGTAGAGCTGGT
TTCTACTGCGATGAAGAAGGAATGTCGAATAATATTAAGGATTGCTCGAGAGGAAATTAC
TGCCCTGAATCATCAATAACTCCAACGAAGTGCCCAGCTGGTACTTATAATAACTAATTC
AATGCTCAGAAGTTAGCAGATTGCAAGTAATGCTTACCTGGAAAATATTGCCTTTATGAT
GGCTTAATTGAACCTTCTGGAGATTGTGAGTAGGGATACTATTGCATTTCTGGATCATCG
TCAAAGACACCTCTTGTTGAAAATACTGATAAAACTTCAGGACCTTGCCCTAAAGGGTAT
TATTGTAAAGTGGGAACCTCTTATCCTATTCCATGTCCAGCAGGAACATATTCAGACTCT
TTCTACGCCATTAACGAATCAACCTGCAAGCCTTGCACAGTCGGTTATTACTGTTCTCTG
GCTGGTCAATCAACACCCTATGGTCCTTGTGATGCTGGTTTTTACTGCCCAGCTGGTTAG
AAATCTCCTAAGCCTGAAAGTTACTACTGCCTACCAGGATACTACTGCCCTAAACAATCA
GGTATGCCCTAGAAAGTACCTGCTGGTTATTTCCAACCTATGCCATACTAATCAACTTAC
TTCAAATGCCCCCAGGGATACTATTGCGAAGAAGGTACCTCTGACTATTCTACAAACTTA
TGTCCTGTTGGTCATAGATGCCCAGAGGGTACAGCTTATGGACAGCAATACCCTTGCTCC
TCAGGTTATTATCAACCTTTAAAAGGTCAATACACCTGCATTATGTGTGATCCAGGTAAA
TACTGTGGAAACTAAGGATTATCAGCGCCAAGTGCTGACTGCACAGCGGGCTTTTACTGC
AGAGCAGGTTCACCTTTCGATTCGCCAACTGGAACCTATAACAGCATAAACATCGGTGGT
ATGTGCTAAAAAGGCTACTATTGTCCCTCTGGTACTGCTTTTATGCTTCCTTGCACCCCA
GGTATGTACTGTCCCTAGATAGGTCTAGCTGCTTCAGAATTAAAGTGTTCTGCAGGATAC
TACTGTCTAACTAAAGCAATTATTGCAACACCTGTTACAGAGAGTGATGGAGGTGGAATA
TGTCCACAAGGATTCTACTGCCCTGAAGCTTCGATCACTCCACTTCCTTGCCCAATTAGC
ACTTATAGTTAAAACTAAGGTAATATAGATGTTTCGGATTGCTCGCCATGTCCAGCTGGT
TTGTATTGTGATTCAACTGGAATGTCCTCTCCGTCTGGTTAATGCGATGCTGGGTACTAC
TGTCCCTAAGGATCGACTAGTCCCAGAGACCCTGATCACATTTGTCCTTTAGGTCATAAA
TGTGCCTAAGGTTCGATAGAGCCTATAGAATGCGATAGCTACACATATCAGGATACATTA
GGTAATGATGAATGCAAAGATTGTCCACCAGGCTATACCTGTACATCAACAACAATTGAA
CTATGTGGTCAGAACCACTATTGCCCTTCCAGTCAAGACAGAGCCACTTGCCCTGATGGA
AGATTCACTTATCAACTTGATGCCTATTCTATCAATGACTGCTTACCATGTCTACCAGGA
TATTACTGCAAAGACAACGCTGATTATAAATTAGTAATGTAACCTTGCCCTGCTGGAGTC
TACTGTCTTGGAGAGGTGGAAAGTGCTGCAGGTACCGCGCTATGCCCAGAAGGTTTCTAC
TGTGAATTGGGTACTTCATAACCTAAAGGATGTCCACCAGGTAAATACTGTAACACCACT
GGTTTATCAGCACCTGTTGGCAACTGCGAAGCTGGATACTACTGCATCCAGAATTCTTCT
TCAAGCACCCCATCGGATGGTATTCAAGGAGATTAATGCCCAAGAGGCTACTATTGCCCA
GCTGGTACATTCTCACCCTTAGCATGCCCAATTGGTACTTACAACAGTAAAATCGGTATG
GAAGCATTAACTGATTGCTTAAATTGTCCTAGTGGATTTGTATGCACTGAGAGAGGTTAG
GATAGTTACGATACAGTATGTCCAGAAGGATTTTATTGCCCAGGTGATACTTCAGTTATT
CAATGTCCAGCTGGATATTATTGCCCTAATAGACTCAAAGAACCAATTAAGTGTCTCTCT
GGTTAATATTAACCAAACGTATAACAATCAGCTTGCCTAGAATGCCCAGCTGGTTTCTAC
TGTTCTCAATTAGACACAACCACTTTGACACCATGTCCTGAAGGTAGCTACTGCCCAGTG
AGAACTGAAGAACCTAAGAAATGCCCAGTTGGAACATACAATCCTTTAATTGGTTAAAAG
AATTTATTGACAGACTGCGTTCCATGTGCTCAAGGTTACTATTGTGATGATGAAGGATTA
ACAACGCCAACTGGATTGTGCTCTGACGGGTACTATTGCTTAAACTCAGCTATTACCGCT
ACACCCGTTGATACTTTGAAGCAAAAGAAATTTGGAGAATGTTTGGAGGGATTCTACTGT
CCATCAGGTACAGAAGCAATGATTCCTTGTCCAATCGGAACAATTAATGACTTGAAAAAA
TAATCAAGTGTTTCTGCATGCTTGTCTTGTCCAGAAGGATATTATTGCGATAGACTAGGA
GCAACTAGGTCAACTTATGGAATAGATATACTTTCAACAACTTATGCCTGTGCTCCAGGA
TTTTTATGCACAGGAGGTGCCAAAAACTAAAAGCCATCTTTATAAACTGGTCAAGGAGGA
GAACTTTGCTCTGAAGGACACTATTGCAAATCTGGAGAGTCAATTGAGTGTAGTGTACTT
TACCACAGTCCCAATAAAGGAGCTCAATCATGTTTAGGATGTCCTAAAGGTAAATATTGC
GATATAACTGCTATGACCACACCAAAAGAATGCCCATCAGGTCACTATTGCCTAGAGGTA
ACAGCTACATTATTAAATAATAATGGAACAAATCTAAATCCTTGCTCAGCTGGCACATAC
AGTGAGTTTACAGGTTTGTGGAGTTAAAGCGAATGCACGTATTGTCCAGAAGGTTAATAC
TGTTTGGGAGGCGGCACATTGCCAGATGGTCTATGCGATGCTGGTTACTATTGTGGAGTT
GGCTCATCTATTTAAACTCCAACTACAACTAAATACATAATGGGTAATACCTAACCAAGA
TAGGGTTAATGCCCACCAGGTTACTACTGTCCACAAGGTACCGTAGCACCTTTACCTTGC
CCAATTGGAACTTACAATCCAGACTACAATCAAGTAGTTTGCAAGCCTTGCCTACTAGGA
CACTACTGTGATGAAAAAGGCCTCGACGGTATAACTGTTCTAGCAAAGACTTGCGATCCA
GGTTATTACTGTATTGAAGGAGCTATAAAGCCATCCCCTACTGATGGAGTGACTGGTAGA
TTGTGTGCAAAAGGAAACTACTGCACAGGAGCATTGATTGAATAATAATGTGCAGCTGGT
TACTATGAACCAAGAGATGGATCATACAAGTGTTAGAAATGCTACCAGGGTTATATTTGC
CCTAAGGGATCTATCCTGCCAACCCCTTGTCCCAAAGGCAAATACTGTCCCGAAGATGCT
CAAGATCCTATAAATTGTCCTGATGGAACCTATGGTCAAACTACAAAGATTTGGGATGCA
TCTCAATGTGCAGTCTGCCCTGTAGGTCAGTACTGTAATGAAGGTGTTATAAAAGGCACT
TGTGCTGCTGGTTATTATTGCGATTAAGGAGCCGTCCAAAAAACAGATTCAGACAAACTT
TGTCCTTAGAGCCATTACTGTCTAGAAGGAACTACCTTGCCAAAGAGATGCCCTAATGGT
GGTATGACCTCTACTAGAGGTGCAAAGACACCCACAGATTGCAAGGAATGCGGACCTGGT
TACTATTGCCTTGAGAACGGTGACACCATGAACTTCTGTCCTAAAGGCTACTATTGCTTC
GGATATCTGGACCCAATTGAATGCCCTACATTTACCTATAACAATCTTAGAGGCATGTAA
GATCCTACTGCTTGCATTAATTGTCCAGCTGGTTACTTCTGTAATACTACAGCAATAAGT
AATTATGAATATTATCCATGTCCAAAGGGTTACTATTGTCCCAAAGAACCAAGTACTGAA
GCTATCATATGTCCAGCTGGTACTTACAACAGCGAGGGTTATGGAGACTCATTGAAATCT
TGCTTAACATGCCCTGTAGGTTTCTACTGCTAGGCTGGTACCATAAACCCTGTTCCATGT
AAAAATGGAACTTACTGTCCAAAAGGATCCAGTAAAACTAGTGATTGCCCCTCAGGTACC
TACTGCCCAACAATGATTGGCAAATAACAGTCATGTCCTGCATCTTTCTACTGCCCCACT
TCAGCCTCTGATTAGTATTTGAAATGTCAAAATGGAACTTACTGCGGCACTTCCTCCTCA
TCTTAAACTAACTGTCCAAATGGTTTCTATGGTTCAAGCAACCCTAATAATGTGAACTTA
GACAAGGGATGTATAGGATGTGATGCTGGATATTACTCAATTCAAGGTAAAAACTAATGT
AATCTATGTACACCTGGATATGTTTGTCTTGGAAACACAAGTACAGCCACACCCACAAGC
ATATCACTTCATGGTGGCTATGAGTGCCCATAAGGTTACTACTGTCCAGAAGGCAGTTAT
TAAACTTATGCATGCCCGAGAGGTTCTTACGGCTCAAAGACAAAACTTACCTCATAAGAT
GATTGTACAAAATGTCCCTCTGGTTAATATAGTGATGTAATTGCATTGAAATCATGCAAG
AAATGCACAGGCTACACATCCTCAGTCGAAGGTTCAACAAGTTGTTCTTGTATTGGTTCT
AATAGAGTTTACCTAGCACAAACTGGTAAGTGTGTCTGCAAAGCAGGATTTGAACCAGCT
GACAAGACAGCCAATGAAAATTCAGATGTGGATTGCGTCGAGAGAATTTATGATACTTGC
ACAGAAAGTCAAATTTAAGATTAATATGGAGTTTGCAAAGATAAGAATGATTGCTCAGCT
GAATGTAATGGAGGCACTGGGACAATTAGTGCTGGCATAGGTATTTGCTAATGCGATGAT
TAAACAACAGCCGTGGATGTATGTGACTCTGCTTGCATGTCAAAATAAAAACAGGTGACT
TTTAATTCAAATGGAAGCATATCGATCTATGATCCAGTCACAAAAACTACATCAATTTCA
AGTTTGAATCAAACAGGGTTAGAAGGATCAGCTTAGTGTTCAAACTCAGACACTTCATAT
TGCCAATTACTTAGTCTATCATCAACTTCTAGTGGAGATTTCGCTGCTGACTTCAGTGTC
CCTTCTTCTCTCACTAAGAGTTCTACGAGTAAACGCATGTTAACAAGCAGAAGTAGATAT
CTACAGACTAGTTAGAATTATGTATCAAACCCTGTGGTATGTATGCCAGGAGGTTCAGCT
TTGATATTTGAGGAGATCAGCAAATCTCACTATCCAGTTTATATGAAGGACTCCCTAATT
AATACAAATTCTAACTTTGATTACAGTTCATTCAGCGTTCTTGAAACTAAACTACTAAAC
GGAACTAAAATAGATAAATTTGTTTTCACTTTCTAAGACTCTGGAGTTTATGTATTTGGT
GATTCAGCCGATAATTCCAGATAGACAATTATCTCAGTGATGCCAAGCTCTCAAAAATGT
CCATCCAATTTGGTTTATGATGCAAAGACCCAAGCCAATTTACTTAAAGTAGGAGTCAGT
GTCAACAAGGACATTATATTCTCACCAGATTGGGGTTTCTTCATAGGTATAGTAGCTGCA
GTTTTAGGTTTGATATTAATCACAGTGCTGACAATAGGCTACGTTTACAGAAAATCTTGG
GCTATGAAAGCATATAGTACAATCGGATATCAGAGAAAACATTACTCACTTATTAAGATT
GATGATCCCTCAGATCATGATGCAATTATCTCAATTAATGCTGATACTGAGTCATTCTCT
TTCCTAAACGAAGGCAAGGACTTAATCCGTACAAGAGAACAGAAGAAACTCTTGGAAGAA
GAAGACAGGAAAGAAAAGCAGAGAAGAGACAAGGAAAAGAAACATCAAGTTCTAGATTTA
GAGGAAGTTGAATAGCTCAAGGATAGACTCAATAAGCATCTCAGTGAAATCAAAAAGTTA
TTTGGAGTTGACTAAACAGGCGATGATGATGACAACGAGGAACTTCTAGGCGGTGACGAT
GAGGAAAACGAATTAAGAGCATAGAAATTGTTCGATCAAATCTCTAAACTCAAAGAATTG
ATTGAGGATAACAGGAGAGTGCTCGAAGGTGACTAACTAGAAGATTCTGAATTGAATGCA
GGCCAAACTGAAGAAGAGAAGGAGAAACTAGAGCAGGAAAAGAAAGAGAGAGAAGAGAAA
TTAAGAAAAGAACAAGAGGAAGAATCCAAGAGACTGAGAGATATCGAGTATCAGAAGCAG
CAAGATAACAAAACTGAAAAGAATCAGAAGCAATTAGATAGCAAGAAAAATGAAGTCTTA
GAGCACTTTGAGAAAGATATGGATCGCAGAAAGCAAGATATGCTCGACAGAATGCAAAAG
ATGGGAGTAACATTAACAGTTGAGGAGTAAAACGCAATGATGCAGTAATTCGACGACAAT
CTCGGTAGAATCGGTGGACTGCTTGAAGAAGACGATGGCTATCAACAAGACATGTTAAAA
CGTAAAATTGAGGAAAGAAAGAATAGACGTAGAAAGCTGTAGGAAAACTTGTCTGATTAA
GAGAAAGCTCTCCAGAAGAAACAAGAAGCCTTCAACGATTAGAAAAACGAAATTGAATAA
GAAGCAAAGGACCAAAATGCTCAACTTGACGCTGAGATTTTACAAGAGAGAATCGTTAAA
AAACAAGGAATTCAAGAAGACCTGGAGAAACTCAAGATGGAGAAGTTGCTTGACTATGAG
GATAAGCTCAAGGAAAGCAAAAACACTAAGGATTTCGGAAAAGTTCTCGATGAATATCAG
GATGCCAGTAAGAGAGTAGATTAGGAGCTTGAGAAGGAAAAGAAGAAGCAGGAGGCTGAA
TTGGAGAGATAACTTAAGAATCGTAAAGGTCAGAGAAGAGCTCAGATTGAAATGGAGAAA
GCTGAGAAACTAAGGGCTTTGCAAGGCATTTAAGATGATCAAACTGAAGCTGACAGAAAA
GGCATTGATGAATTGAAAAATCTCATTGCTTTAGATGAAGGTACTAAACAAACTGGAAAT
GCTCTCGATAAATAGATTGACAAGATCATACAAAATGTGAACTCAATGAGCGATTAAGGT
CTATCAAGAAAATCCACTCTCAGAGGTGCAATAATGAGCAACGACGGTCAATTATTAAGC
CCTCACTCCAGCAACAGTGCCATGAACAATTCATCCTTGATGTTAGATAAAATGAAGAAA
GGATTGATGAATGACTTGGACAAAAAACTGTAGTAACAAGCCAAGGAGAGAAGAGACATG
GAGAAGAAAATGATTGAAGAGGGACAGAAGCTTGATGACGAAGTCGATAGAGCAAAGTCA
GATAACATGCAGGATTTGAAGAGTGAGATGGCTAAGAGAGATGAGTTGAAGAGAAAACTA
AGTGAAGGCACTTCATCTGATCTTGAAAAATAACAAATAATAGACTAATTGGAAAAAGCC
GAAGAAAACATCAAGAACAAAATCGATCAGCAAAACTAAGAGCAAAACTCCACACTTGCC
AAGAAACTGGAAGCACGCAGAAAACGCAAATAAGAGTTAGCTGAGTAGGAGTGA


>Contig4658.0.g2(protein)
MYSQTRSKFQSLNISKFKVFKPPPQAMSLKLASACPAGYECDGSGVQLAACTSGYYALLN
DGVCTQCPAGSYCANNYESPLACSGTGTEQYSPAGSTTCYQCPAGKECPSISATPTDCSS
GEYSLLGDTGCTTCPAGSKCASLDQSPVSCSSGEYSAAGATSCITCQAGYYCASTTSSPV
QCSGTGLEQYALAGQTSCSQCPAGYSCPDIYSIPTVCSSGYYALAGDRSCTQCPAGSMCS
TTTASPVACSSGEYSSAGAISCTQCPAGYKCPSTTSSPSQCSGTGLEQYSLAGQTSCSEC
PAGYSCPDIYTTPAACSSGQYSLAGELTCTSCPAGSECPSTTASPTTCSTGYYSLGGAAA
CTQCPAGYECPSASSSPSVCSSGYYSLDGQSSCTQCPAGSKCPTTTVAPIACLGTGLEQY
SVAGSTVCSQCPAGYECPTTSSAPTACTTGYYSLIGGGTCIQCPAGSECTSTSISPVACS
SGSYSLAGQTSCTTCPAGSQCPSTSTSPVACSSGEYALSGSISCTTCLAGYKCPSTSSSP
TQCSGTGLEQYSLAGSTSCSQCPAGSSCSDIYSTPVACTSGYYSLAGESTCTQCPAGSQC
PTTSASPTACSSGQYALSGATSCTPCPIGYECPNTNQSPTACTSGYYASSTLQTACTQCP
AGSQCPSTTVNPVACTSGQYSLAGYTTCEPCPAGFKCPTTSVAPIQCSGTGLEQYSLSGA
TSCSQCSAGFSCPDIYTTPIACSFGTYSLAGGATCISCPAGSECPSTSSSPVSCNSGYYS
LIGGGTCIACPKGSKCPNNNELPTTCEDGYYQSATAQSTCIICSVGKQCADKTIDPVVCS
GSPTEQYSPGEVMACQKCPAGYACPTVYVKTACAVGTYALEGDAVCNTCPFGYGCTDPAS
SPVACTSSQYSLPGISECLLCPPGYECPTTLMIPQLCQEGYYSKQGDGKCSICPAGYSCL
KRTSDPVACSSGYFSIQGQGYCDKCPTGYYCPTTTQSPFKCPAGSYSLSGQSSCTDCPVG
KFCPATNTPQAYDCPSGYYASVTNQVSCTACPAGYSCSDPTVNPVPCTEGYYSFGYAGTC
TQCPAGFYCPKANAQPVLCPAGKQSAAGQSECLECPDGVTCTRSDGIIQDPCTSGQYRVN
DGRIEICRDCPPGHMCPTITSQPIICPSGTFAKFAQTSCTACAAEHFCPSLGADAQEQCP
PGTFQPLTSKTYCNECPPGHYCSSTLVASATACPAGKFAPYGNQTSCLSCPAGFFCPTEG
LTVPIQCPVGYYSSTDAEQCTMCEAGYACPSGYFSDRYSCESGSFSYASSTYCFQCPIGK
SCLLSGSVLTVQNCPLGYYSDMGSIACSQCPAGKSCHTMDSLGIIDCESGWYSLIGETNC
QPCPAGFMCPNKDGTGIAQCSDGEFAPIGSSKCFTCPKGNYCPYKHIAFIEQCPPGTYST
GNQNICKECPEHYECPHRDSKIDVKDGYFSPKGTGVALRCRAGWYCSMTSTPRVVRPCEP
GYYSNTGSSSCTACPIGSSCYLQDVYTSQVTCPEGYYQDEAGKTYCKKCLDKTFKTDRSA
ETCSSYTDGYEFIFGGFTQQKQCPYGSYSTGATVTDESKLVCQDCQAGGICTTGATSDVT
TVSCYSGFWCNHLQGSNALYAMFPCPPGYKATGLTNAKTRDEACTQCTAGVYCEGANTPE
QTCIKGHYCPAFTTRATQYPCPAGTYQDQLGKTAVSDCITCQSTYYCPQGSSKQIQCPPG
TICNSTELREYQMVPCPAGFYNPNLGQTTCVSCPLGAFCPSGSAYPQLCPPGTYNDQPEQ
KQKTDCKTCPDNYVCSVFGLTDYDDISQPNIEAGYLSPAGVQYAQQLPCPPGTIDNDKNL
TNINECDLCPAGSACELGTALTAYTRKMVICEPGYYCPTGTLHDKQYPCPGGTYSAAHDL
TLSTQCNQCPAGYFCPPGSYKPFICPGGYFCLAGTENFQHSPCSNGTYSYKKGLTSAIEC
TICPTGHFCREHSTQPEKCPKGTYNDVQGAFIADNSIVSNSGSIKTCKICSEGYYCPTEG
MSAMIKCPKGTYSPSGSYICLECQEGHDCQTTDGITFTDYKANKNTPNGYYSDGVVQYIC
PPGHFCPTATKIYHQCPSGTYMPNSLIDSVNYVGNSQSNQCIKTPAGYFTQLRASTSYSD
NICELGYYCPEGSNNAYVNRCPRGFYTDEFQSTSCKTCPAGYYCDEYNIYPVICPQGYYC
PAQTYEPTPCSKGTFGSLLGNQASTDCLSCLPGQYCSQAGLSAPDGLCDPGYFCKGGAYK
ADPTDGITGDVCTAGGFCEYGSKRVKECPPGTYNPNTKAKTQTDCIQCLPGYYCAGANLP
LPTAKCEAGYYCPSGSSNSKQLTSPPGYFSLEGAASPTICPQGTYNQFTSKSECTKCRAG
FYCDEEGMSNNIKDCSRGNYCPESSITPTKCPAGTYNNQFNAQKLADCKQCLPGKYCLYD
GLIEPSGDCEQGYYCISGSSSKTPLVENTDKTSGPCPKGYYCKVGTSYPIPCPAGTYSDS
FYAINESTCKPCTVGYYCSLAGQSTPYGPCDAGFYCPAGQKSPKPESYYCLPGYYCPKQS
GMPQKVPAGYFQPMPYQSTYFKCPQGYYCEEGTSDYSTNLCPVGHRCPEGTAYGQQYPCS
SGYYQPLKGQYTCIMCDPGKYCGNQGLSAPSADCTAGFYCRAGSPFDSPTGTYNSINIGG
MCQKGYYCPSGTAFMLPCTPGMYCPQIGLAASELKCSAGYYCLTKAIIATPVTESDGGGI
CPQGFYCPEASITPLPCPISTYSQNQGNIDVSDCSPCPAGLYCDSTGMSSPSGQCDAGYY
CPQGSTSPRDPDHICPLGHKCAQGSIEPIECDSYTYQDTLGNDECKDCPPGYTCTSTTIE
LCGQNHYCPSSQDRATCPDGRFTYQLDAYSINDCLPCLPGYYCKDNADYKLVMQPCPAGV
YCLGEVESAAGTALCPEGFYCELGTSQPKGCPPGKYCNTTGLSAPVGNCEAGYYCIQNSS
SSTPSDGIQGDQCPRGYYCPAGTFSPLACPIGTYNSKIGMEALTDCLNCPSGFVCTERGQ
DSYDTVCPEGFYCPGDTSVIQCPAGYYCPNRLKEPIKCLSGQYQPNVQQSACLECPAGFY
CSQLDTTTLTPCPEGSYCPVRTEEPKKCPVGTYNPLIGQKNLLTDCVPCAQGYYCDDEGL
TTPTGLCSDGYYCLNSAITATPVDTLKQKKFGECLEGFYCPSGTEAMIPCPIGTINDLKK
QSSVSACLSCPEGYYCDRLGATRSTYGIDILSTTYACAPGFLCTGGAKNQKPSLQTGQGG
ELCSEGHYCKSGESIECSVLYHSPNKGAQSCLGCPKGKYCDITAMTTPKECPSGHYCLEV
TATLLNNNGTNLNPCSAGTYSEFTGLWSQSECTYCPEGQYCLGGGTLPDGLCDAGYYCGV
GSSIQTPTTTKYIMGNTQPRQGQCPPGYYCPQGTVAPLPCPIGTYNPDYNQVVCKPCLLG
HYCDEKGLDGITVLAKTCDPGYYCIEGAIKPSPTDGVTGRLCAKGNYCTGALIEQQCAAG
YYEPRDGSYKCQKCYQGYICPKGSILPTPCPKGKYCPEDAQDPINCPDGTYGQTTKIWDA
SQCAVCPVGQYCNEGVIKGTCAAGYYCDQGAVQKTDSDKLCPQSHYCLEGTTLPKRCPNG
GMTSTRGAKTPTDCKECGPGYYCLENGDTMNFCPKGYYCFGYLDPIECPTFTYNNLRGMQ
DPTACINCPAGYFCNTTAISNYEYYPCPKGYYCPKEPSTEAIICPAGTYNSEGYGDSLKS
CLTCPVGFYCQAGTINPVPCKNGTYCPKGSSKTSDCPSGTYCPTMIGKQQSCPASFYCPT
SASDQYLKCQNGTYCGTSSSSQTNCPNGFYGSSNPNNVNLDKGCIGCDAGYYSIQGKNQC
NLCTPGYVCLGNTSTATPTSISLHGGYECPQGYYCPEGSYQTYACPRGSYGSKTKLTSQD
DCTKCPSGQYSDVIALKSCKKCTGYTSSVEGSTSCSCIGSNRVYLAQTGKCVCKAGFEPA
DKTANENSDVDCVERIYDTCTESQIQDQYGVCKDKNDCSAECNGGTGTISAGIGICQCDD
QTTAVDVCDSACMSKQKQVTFNSNGSISIYDPVTKTTSISSLNQTGLEGSAQCSNSDTSY
CQLLSLSSTSSGDFAADFSVPSSLTKSSTSKRMLTSRSRYLQTSQNYVSNPVVCMPGGSA
LIFEEISKSHYPVYMKDSLINTNSNFDYSSFSVLETKLLNGTKIDKFVFTFQDSGVYVFG
DSADNSRQTIISVMPSSQKCPSNLVYDAKTQANLLKVGVSVNKDIIFSPDWGFFIGIVAA
VLGLILITVLTIGYVYRKSWAMKAYSTIGYQRKHYSLIKIDDPSDHDAIISINADTESFS
FLNEGKDLIRTREQKKLLEEEDRKEKQRRDKEKKHQVLDLEEVEQLKDRLNKHLSEIKKL
FGVDQTGDDDDNEELLGGDDEENELRAQKLFDQISKLKELIEDNRRVLEGDQLEDSELNA
GQTEEEKEKLEQEKKEREEKLRKEQEEESKRLRDIEYQKQQDNKTEKNQKQLDSKKNEVL
EHFEKDMDRRKQDMLDRMQKMGVTLTVEEQNAMMQQFDDNLGRIGGLLEEDDGYQQDMLK
RKIEERKNRRRKLQENLSDQEKALQKKQEAFNDQKNEIEQEAKDQNAQLDAEILQERIVK
KQGIQEDLEKLKMEKLLDYEDKLKESKNTKDFGKVLDEYQDASKRVDQELEKEKKKQEAE
LERQLKNRKGQRRAQIEMEKAEKLRALQGIQDDQTEADRKGIDELKNLIALDEGTKQTGN
ALDKQIDKIIQNVNSMSDQGLSRKSTLRGAIMSNDGQLLSPHSSNSAMNNSSLMLDKMKK
GLMNDLDKKLQQQAKERRDMEKKMIEEGQKLDDEVDRAKSDNMQDLKSEMAKRDELKRKL
SEGTSSDLEKQQIIDQLEKAEENIKNKIDQQNQEQNSTLAKKLEARRKRKQELAEQE