Identifiers and Description

Gene Model Identifier

Contig4642.0.g78

Standard Name

None

Aliases

Contig4642_0_g78

Description

Transmembrane amino acid transporter protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01490 ) Transmembrane amino acid transporter protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003992701.9990449803848145e-49Transmembrane amino acid trans
porter protein
SGDYKL146W9.99893167504554e-35AVT3 SGDID:S000001629, Chr XI
from 171783-173861, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4642.0.g78(coding)
ATGTCTAAGAAATACAAATAGAAGTTTGAAGAGTCTCCTCGATCCTCCCACTCGCATGAT
ATGTACGAGGAAGTTGAGACTCATAATTCAGGATATATTCCACAACAAGATAATCCTCAC
TAGAATCTTGCCAATAGAAGTCTCAATTAATTTGATTAGATTCACATTGATTTTGGGTCA
GAAAATAATGACGATTACGGAGAATACAACATGAATAATCATTAACAATTTACAAGCCAA
AATCAACAAAATAACCTAACAATAGACTTTAATGACTAGAAATTTCAGAGTATTGATATG
AGGAATAGCAATTTAAATATAGACTTATAGGAAATACATCATCATCACAATGGAAACACC
CTCAATAAAAATGATCCACATTTTTAAGATATTTCTCTATCAGGAAGACATTCAATAAAA
TCATAGACCTTGGGATAATCCAAAATTAAATACAATGATGAACTCCCTCATCGATAAATA
ATCGTACCAGGTTTGGATGACACTCCTTCTGATACGCATGAAATACATAATATGGATAAA
ATTGATGGAGAGGAGACTTATAATATTAACAACATTTCAATCTTGGATGATGAATTCGGA
TCGGGAAATGTTGGGGTGTTGGGCACAAGCTTTAACATATTTAAATGCTTCGTGGGAATT
GGAATCCTAGCAATGCCAAATGCTTTTTCTGATTTCGGAATAATAGGAGGAGCTTTAGGT
ATTTTGATAATTGGCACACTGAATCTTTACACAATGAGACTCTAAATATACTGCAAAGAA
AAATACGGGTCTAAATATGAGACATACTCTGACCTGGGCCATGTTATTTTTGGTCGATTG
GGCAAATTAGTAGTGGAATTTTGCTTGATATCCTCACAGTTAGGTTGTGGAGTGGCTTAT
TTACTTTTTATTGGGAAGCAGGTTGATCAAGTAATTTGCTAAGCATCAGACTTTTGCAAT
AAAAAGTAGTTGTATATTGCTATAGCTGCAATGATATTAATGCCTCTATGCTGGCTTAAG
ACATTTAAGAAAGTTTCATATATCAGTGGTTTTGCAAATGTCTCAATTGTTTTTGCTTTG
ACAACTATAATATGCTACAGTTTGCAAAACATAAGTGATAACTCAGACACACTTAAGAAT
TTAAACGCATTTAATCCAATGAATATTCCGCTATTTTTTGGGGTAGCAGTGTTTAATTTC
GAAGGCAATGCTGTGATCTTGAGTCTACACAAATCCATGAAGGAACCTGAAAAATTCGCT
CCTCTGTTGAAAACCATGATAACAATCGTTATATGTCTGGTTATTTTATTAGCTACTATA
GCTTATGCGGGTTATGGATCTGATATAGAAGACATAGTGACATTAAACCTGCCAAATAAT
GGAGTGTCTAACTTAGCGAGAATCATGTATTGCTTTGGACTAATGGGATCTTATCCAATT
TAAGTGATTCCAGCATTAGAGATAATTGAGAAGACAACTTGTTTCATGAAAATACCCTCA
GCTCCTATTTGGCCTGGTTTAAAAATCTACCTTTACCGTTCAATAATTGTAATTGGGACA
GCTATTTTCTCAATAGTAATACCTAAATTTGGCAGTTTTCTAAATCTTTCAGGTGCTTTT
TCAATGACTATTCTTGCATTTATTATGCCACCCTTAATGTACAATAAAGCCTACTACTCC
GAGATACCTTTGAAATAGAAATATTTGAACTATTTCATTCTGGGATTTGGAGTTGTATGT
GGAATTATGAGTGTCTATGTGTCCACTGTAGAGTTATTCGAAGCTTTAAATAGTTAATCC
GATAATTGA


>Contig4642.0.g78(protein)
MSKKYKQKFEESPRSSHSHDMYEEVETHNSGYIPQQDNPHQNLANRSLNQFDQIHIDFGS
ENNDDYGEYNMNNHQQFTSQNQQNNLTIDFNDQKFQSIDMRNSNLNIDLQEIHHHHNGNT
LNKNDPHFQDISLSGRHSIKSQTLGQSKIKYNDELPHRQIIVPGLDDTPSDTHEIHNMDK
IDGEETYNINNISILDDEFGSGNVGVLGTSFNIFKCFVGIGILAMPNAFSDFGIIGGALG
ILIIGTLNLYTMRLQIYCKEKYGSKYETYSDLGHVIFGRLGKLVVEFCLISSQLGCGVAY
LLFIGKQVDQVICQASDFCNKKQLYIAIAAMILMPLCWLKTFKKVSYISGFANVSIVFAL
TTIICYSLQNISDNSDTLKNLNAFNPMNIPLFFGVAVFNFEGNAVILSLHKSMKEPEKFA
PLLKTMITIVICLVILLATIAYAGYGSDIEDIVTLNLPNNGVSNLARIMYCFGLMGSYPI
QVIPALEIIEKTTCFMKIPSAPIWPGLKIYLYRSIIVIGTAIFSIVIPKFGSFLNLSGAF
SMTILAFIMPPLMYNKAYYSEIPLKQKYLNYFILGFGVVCGIMSVYVSTVELFEALNSQS
DN