Identifiers and Description

Gene Model Identifier

Contig4578.0.g7

Standard Name

None

Aliases

Contig4578_0_g7

Description

Septin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003165606.999211576891585e-27Cell division protein
SGDYHR107C2.999758165421992e-18CDC12 SGDID:S000001149, Chr VI
II from 328036-326813, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4578.0.g7(coding)
ATGATACCATCTAATTAAAGTGGTTTTTCACATAAAACACAACATCCACAGAAATCTGCT
ACGTCCCCACAGTTTCATCAGAAAAGAAAGCCATCCATTTATGACCAGGAAGAAACCAAG
AGAGAAGATGAAATGAACTTTAATGGGATGTTTGGTAACACATCGCAAGACGATAACACT
TTGGACTCACAAATGCTTTACTCCTCATCCCAATTGCATCAACAAGAGCTAAATGCGGGT
CTAGGAATGAACTTCAACAAGGGCTTCCAAGATTAAAATGAGTTTATGAAAGCTTAGTAA
CTCGATTGTCAAAAGTGTTTATCAGACTTCGATGAAAATAATGGACAGTAACACTCACAC
TTGGGTACCTCCTATTTGACAGGATAGAATCAGAATAGTATTCACAGAGATCTGTAAAAT
ATAAGCAGGAAGAACAAAGAGTAGCATTAGAATATGCTTTTCAAGGCTCAAACTCACAAA
GAATTCGACTTGAATAATGAGCTATACAGAGAGGTAGATATTCAAAAATTTGATAGAATT
TATGAGAATCAATTCGATATTAAATCTGGTACCTCTCAAATTTAAAAGAGTAACTTGAAG
ATTTTCAACCATCAATCTTAAACTTAAAAGTTAAGGAATTCTAATTCTACGTCATCACTT
AATAAAGCCCAGTCAAACTAATACACGAAAAACTTCATTAGTGGAATAAATCCTATGAAG
GATATCTTGAAATTGTAGGAAAGTGTTAACAGCCTTCCTAAAAAGAAACGGCTAAATAGT
TAGAAGCAACAGTCTTTCAAAGATTCTGAATACAGAAGAAGCGTCGATTTGCTCGGTACG
ATTGTTGAAGAAGATTAACGATAGTCAAAAGATTTGGAGGCTTCAGACAGTAACTTCTTC
TACAATAACAAGTCTCCAATTAAACAGAGCTCAGAGTACATTGTTAAATAAGAGAGCAGC
AACAGTAGTACTGAATAGGAAAAATACTTGAAAAACATTTATTAAAACATGATTCCTTAG
GATAATATAGAAGATGCCTAAACTTTCCATAAAAATGCCCTTGCTGCTTAAACATAGAAG
TAGCCAAACTTTTTCATAGACAATTTGAGACCATCATCTGGGTTAGGGGATCAACAAAAG
ACTCACTAAGATTACAAGACTAGCAGAAACAGTACTAATAAATTTAAGAAAATAGAATTT
CTTTAATCCCCTAAGAAGTCGAGAGGAGATCGGCTATACTCACATGAAGATCCTTTTTTC
GGGAAAGCTCTAATTACGGATGAAGAAGTCGATCATCACAGATCAAAGAGATAAATAGAC
CATAAGAGATTAACAAATGATCAAGACTATTGCTATGAGAAAAATAACTAAACTGATCGC
GAGAGCTCCAGACCAGCTAGATCTTCTTCTTTCAAAATAGATACAGATATTTTACCCAAC
CATTTCAACTTGAAGAAGAAAGATTCAAAAAATACCCCAAACAGTAATAGAGGGGGCTTG
ATCATAGCAGAGACAGATTCTAGAATTATAAATTAGCCAACAATTAATGACATAATTAAT
CACTACGGTAATACTTAAGCTAACAGTTCTCGCAACTACAACATTTAAACCAAAAGAAGC
AACGTTGATCAAATTTAAGAGGTGCTTTCCAACGAAGAATCAAAAGTGCCATCCCCTCAG
AATGAACTCAGGAACTCTTATGGTCCTACAGATCAGGATGGTGTAAACTTAAACAGAGAA
AATATGGGCAACATTAAATTCAAGAAATCAGTGGAATCATAGCTTTAATCTTCAGAGCAT
GTCAAGTAGCAAGCTCAATTACATTTAGAACAAAAGATTAAAGATGGTTATGATGAAGAT
TCAGAGAACTCTTCTGAGGATCAGGATGACTTTTAAGAGGAATCAAAATCTTCTAAGAGC
TTAATTAATGGCTAATAGAATTTATTATCAAGTACTTATGATATAAGTAGCAATTTGAGA
CATAAACACAGCAAACTTAATGTTATGGTGTGCGGTCCAGCTGGAATAGGAAAGACTTCC
TTTTTGAAGGTTTTCCTGAAGAAATTTGACAAGAATCAGTTCAAAAGCGTTTCAAAAGAT
AGAAGTAAACAATAAACATCAAAATTGAATACGGAATAACAAACCCCAATAATAGATCAT
TCCAGAGACCCAAATCACAAACAGACAATCAAAAACAAGATCACAAGAGATGTAATTGAG
TATGACGTTCCAAAAACTATTTCAAACAAAAAGATTTCTCTGAAGTTTATAGATTCGGTG
GGATATGGGGATTGTATGGACTTGTAAAGCTGGAGAAAATACATTCAAAAGTATATCAAG
AGCATGTAAATTGAGTACATGAAAGAACACGAAAGAATCATGACTACTTCTAGAGACAGA
TACTAACAATAAAATGAAATAAACAAGATTCCAGACAATAGAGTCCACTTACTACTGTAC
TTCTTTAACGGGCATCACACGAATGAATGTGATTTCGATATGATAAAGAAGCTACAGAGA
TTTGTGAACATACTGCCGATGATAGCTAAGGGGGATAGTTTCAAACCTGATGAACTGCTT
ATTATGAAAAATGATATTGCAATTACAGCTAGGAATAGAGATATTCACTTTTTTGATTGC
ATCCACGCAATTAAAGAAAAAGTGAATACAGATGAGGAATGCAGATTAATATCACAGGAA
CTCCTGAACACTGGATTGAATGAAGAATCAAAGTCATCTACTCACTATTGCCCACCATTT
TCCATCGTGAACCCAGTTGACAAGAAAGTAATCATGAAGGATGGAAAGAGACATGTGACT
TATGGCAGAAATTACTCTTATGGATTTTGCGATGCATTCAGTGACGATCACTCTGATTTC
GGCAGACTCTACAAGCTAATAACAAACATAATATGGGATTAACTGATTGAAATCACGGAT
AAAAGCATCACAAACGAGTATATTATGAGGAGAAGAGAGAAAGAACTGCTTAAAAAGACT
CTAAAAACTAAGGATTGTAGAGTACAATAAACTCTTATTGGACTTGGTCTTGCTGCTATT
GGAGGTGTCTCTTTCATAGCAATGAAATTCAGAAATAATTAATGA


>Contig4578.0.g7(protein)
MIPSNQSGFSHKTQHPQKSATSPQFHQKRKPSIYDQEETKREDEMNFNGMFGNTSQDDNT
LDSQMLYSSSQLHQQELNAGLGMNFNKGFQDQNEFMKAQQLDCQKCLSDFDENNGQQHSH
LGTSYLTGQNQNSIHRDLQNISRKNKEQHQNMLFKAQTHKEFDLNNELYREVDIQKFDRI
YENQFDIKSGTSQIQKSNLKIFNHQSQTQKLRNSNSTSSLNKAQSNQYTKNFISGINPMK
DILKLQESVNSLPKKKRLNSQKQQSFKDSEYRRSVDLLGTIVEEDQRQSKDLEASDSNFF
YNNKSPIKQSSEYIVKQESSNSSTEQEKYLKNIYQNMIPQDNIEDAQTFHKNALAAQTQK
QPNFFIDNLRPSSGLGDQQKTHQDYKTSRNSTNKFKKIEFLQSPKKSRGDRLYSHEDPFF
GKALITDEEVDHHRSKRQIDHKRLTNDQDYCYEKNNQTDRESSRPARSSSFKIDTDILPN
HFNLKKKDSKNTPNSNRGGLIIAETDSRIINQPTINDIINHYGNTQANSSRNYNIQTKRS
NVDQIQEVLSNEESKVPSPQNELRNSYGPTDQDGVNLNRENMGNIKFKKSVESQLQSSEH
VKQQAQLHLEQKIKDGYDEDSENSSEDQDDFQEESKSSKSLINGQQNLLSSTYDISSNLR
HKHSKLNVMVCGPAGIGKTSFLKVFLKKFDKNQFKSVSKDRSKQQTSKLNTEQQTPIIDH
SRDPNHKQTIKNKITRDVIEYDVPKTISNKKISLKFIDSVGYGDCMDLQSWRKYIQKYIK
SMQIEYMKEHERIMTTSRDRYQQQNEINKIPDNRVHLLLYFFNGHHTNECDFDMIKKLQR
FVNILPMIAKGDSFKPDELLIMKNDIAITARNRDIHFFDCIHAIKEKVNTDEECRLISQE
LLNTGLNEESKSSTHYCPPFSIVNPVDKKVIMKDGKRHVTYGRNYSYGFCDAFSDDHSDF
GRLYKLITNIIWDQLIEITDKSITNEYIMRRREKELLKKTLKTKDCRVQQTLIGLGLAAI
GGVSFIAMKFRNNQ