Identifiers and Description

Gene Model Identifier

Contig4562.0.g74

Standard Name

None

Aliases

Contig4562_0_g74

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001909509.997093137033517e-262actin, identical
SGDYFL039C9.997093137033517e-262ACT1 SGDID:S000001855, Chr VI
from 54377-53260,54696-54...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4562.0.g74(coding)
ATGGAAGAAGAGGTAACGGCAGTTGTGATTGATAATGGATCAGGAATGTGCAAAGCTGGT
TTTGCAGGAGACGATGCTCCAAGATCTGTATTCTCAACCATAGTTGGAAGACCTAAGATG
CCAGGTATCATGGTTGGTCTCGATTAAAAAGAGGTATACGTGGGAGATGAAGCTCAACTA
AAGCGTGGAGTTTTAAAAATTGAATAGCCAATTGAACATGGTATTGTAAAGAATTGGGAC
GATATGGAGAAAGTATGGCATCATACTCTCTATAGCGAACTCAGAGTCTCTCCAGAGGAG
CACCCTATTTTGATGACAGAGGCACCACTTAATCCCAAATAAAATAGAGAAAAAATGACT
CAAATTATGTTTGAAGTCTTCAATGTACCTTGCCTCTATGTCTCAGTTCAAGGAGTTTTG
GCTCTCTACTCTTCAGGTAGAACTTCTGGTGTTGTGCTTGACTCTGGAGATGGAGTTTCA
CATACAGTTCCCATCTATGAAGGTTACGCAATTCCTCATGCCATTCAAAGAATTCATTTA
GCTGGAAGAGATCTAACTGACTACCTAAAGACATTATTGGCCAAGAGAGGATATAACTTC
ACCACAGCAGCTGAACTTGAAATCGTCAGAGATATCAAGGAAAAGATGTGCTATGTTGTA
AATAATTACGAAGAAGCCTTAAAAGAAGCAGATGAGAGTCATGCATGCGAAAAGAACTAT
GAACTTCCTGACGGCAGAAAGATTCTAATTGGTTATGAAAGATTTAAATGTGCTGAAATT
TTATTCTCACCACAACATGCAGGCCATGATTTAGAGGGAGTACATAAATACACTTATGAT
TCAGTTATGAAGTGCGATGTAGATGTAAGAAGAGATCTTTTCCAAAATATCATCCTTAGT
GGTGGTTCTACACTCTTTGAAGGCATGGGAGAGAGAATGTGGCAAGAAATTCATCAATTG
GCGCCTTCTACTAATAAAATAAAAATTCTTGCTCCTCCCGAGAGAAAGTACTCAGTATGG
CTTGGAGGTTCTATTTTGGCATCACTTTCAACTTTCCAAACTATGTGGATAAATAAGCAA
GAGTACGACGAGTCAGGTCCAGCAATTATTCACAGAAAATGCTTTTGA


>Contig4562.0.g74(protein)
MEEEVTAVVIDNGSGMCKAGFAGDDAPRSVFSTIVGRPKMPGIMVGLDQKEVYVGDEAQL
KRGVLKIEQPIEHGIVKNWDDMEKVWHHTLYSELRVSPEEHPILMTEAPLNPKQNREKMT
QIMFEVFNVPCLYVSVQGVLALYSSGRTSGVVLDSGDGVSHTVPIYEGYAIPHAIQRIHL
AGRDLTDYLKTLLAKRGYNFTTAAELEIVRDIKEKMCYVVNNYEEALKEADESHACEKNY
ELPDGRKILIGYERFKCAEILFSPQHAGHDLEGVHKYTYDSVMKCDVDVRRDLFQNIILS
GGSTLFEGMGERMWQEIHQLAPSTNKIKILAPPERKYSVWLGGSILASLSTFQTMWINKQ
EYDESGPAIIHRKCF