Identifiers and Description

Gene Model Identifier

Contig442.1.g3

Standard Name

None

Aliases

Contig442_1_g3

Description

ATP synthase subunit H

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004744800.0000000000019997478866288316hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig442.1.g3(coding)
ATGGGAGCAAAAGAGGATGGACTTTGGACAGGCACTTTAATTTTCTTGGGCATATTCGTA
TTCGGAGCTGGTATTCTTGGTCAGTACGTTTACGCTGTCACCAAGGAAAGATCACAAGCA
GCTGACAATAGAAAAATGACATTCGGTCTAGTTTTCATGGCTGTTTTCTGTATGTGGACT
CTCTGGATCTGCACCTACATGCACTAAATGTACCCCTTGGTCAAGCCTGAGTTAAGCTGA


>Contig442.1.g3(protein)
MGAKEDGLWTGTLIFLGIFVFGAGILGQYVYAVTKERSQAADNRKMTFGLVFMAVFCMWT
LWICTYMHQMYPLVKPELS