Identifiers and Description

Gene Model Identifier

Contig442.1.g2

Standard Name

None

Aliases

Contig442_1_g2

Description

Zinc-finger domain of monoamine-oxidase A repressor R1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10497 ) Zinc-finger domain of monoamine-oxidase A repressor R1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004204002.998800627344286e-26hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig442.1.g2(coding)
ATGACATCGACTGATAGAAAGAAAGGAGCAGTAGATATGAAGTAGTTTTGGGACTAGATA
GACAAGGATTATTTTCAAGAGATCAATCAAGAAGACATCCTTCATTTTATTGATAGTTTG
AACTCACAAATTGATCATCATTATTCAGACAAGAAGGAAGCACTCTTTTCTCAAAATTCA
CAGAGTGCTTCAAAGGGTGTCCTTGTCGTAAACAAATCGCAGACACCGAAGCCATCCCAT
GTTTCTGTTTTTTCAACTGGAACCAACCAACTTTTGAAAAGAGAAAAAATCTCCCAATAA
AATTTAACTAATTAAGACTTACCCAAAGATTCTTAAATCGAAGAGTCTAATAGTTAATCT
TTAATTCAGAGACCACAAGGTAAACAGTCAGCAGGGATTTTACCCTCTTAAAAGGCTAGG
CTAGATTAAGAGCGCTTGCTGACCTCTCACACCTTTGAAGACGGTGGAATGTTTGGCCCA
GATTTATCAAGGTTTATGTACATGTATCGACAAATTTTGGACCGATATGACATTCCTAAT
TAATTATAGGAACTTGATGATATTCAGATGAGTGAGACTTAGATTAAGCTTCATGAATTG
AGATTGATAGAGGAGTTAAAAGAACAAGTTGGACAATTATTCAATTACAGATTTTTCAAG
ACCTCAAAAGAATTACCAAGATTGAAAAAGTTCAAACCTCCCACCTTAAATATAACTATC
GACAGTGAGCTTGATAAGCTTGAGCACGAGTATGGGATTGCTCAAAGAGAATCAAGGCAA
GGACTGAAAAGATTCAGAAATGCAGTTTTGAGCTATTAGTAGCCTGAAAGTGTTATAATT
CTCAAAGAGAAATCTGAGATAGAGAGACTTTACTTGCAGAAGACAATTATCTAAATGGAG
CTTAAGTAGCTAGCTGAATCTATAACCAGAATATCCAGTAGAAAGAATATCAAATCTTCT
GACGAGCTATACAGATTTATGTAAAATAGTCCAATGATATGGGATAAGAGAACAAAGCAA
GATAATTATGTGTCTGAGAGAAACAGGAAAAAAACTGGCTGGAGTTAAAAAATTAGAGAA
AGTTAGGGTGCGAGATAACATGATGAACCAGTTTTCGATCAAAAGTGGGCAGTGGATGAA
ACATATGCGTATTCACTTAAATTTGATCCAAGCATAGGTGTTCCTGATACCTGGATTGAT
GGGAGAGTAATGAACTACTTTAACGCATAAAGAGACAACATTTTTGCTTCTTCTTCTAAA
TATGACATTGTATAATTAAGATAAGGAGAAGCTCATTACCATACAACTTCTGAAAATACA
AATGAAGAATAAAAATAGAAATAAAACAGAATGCTAAGAAATAGACATAATAGGAATTTG
AGTGCAAGAAAGAGATCAAAGTCAACACCAGCACCACCTAATAATCCAGTACTCGGCCCT
TAGGCAATGCTTGAGCAACAAATGAAATATTTTGACGAAGACAAATCTAATTATGGCTTC
TGCCATCACTGTAAGCAACTCAAGAATAGGTTTGTTCTTGCCAAGTGCAACTATAACTCA
GCATAAATGGGGCCAACAGTTCCTGCCTCTTACTGTGTCAAGGACGTTAAGATATACAAC
ATTGATATTGGGAACAAGGCGTCATACAATTATTTGGTAAAGCAACATACAACCAAAGGC
AAGAGCGGGATTAATACCCCCTTTCTTTTCAATGAACTTTAAGCTTAAGGCATTAGAAAG
GATCAGAGGGGTAGATCAAGACTGAACTCGGAAGTGCTGGATGACAATTATATTTGCTCA
AGAATGTTTTGCTCATTTTGCCTGAAGACCTAATACGAAGTTAACTTTGGTGAGTGTTAC
AATAATAAAGATTGGATATGCCCTTTCTGTCAAGGAGTTTGCTTCTGTACAAGATGCCTA
CGATAAGACACTATGACTTAGCTTAAGGCTTACTTCATTGCTCTTGGAGGAGATCTGTAA
AATTTGCAGAGCTCGGAATGCATATTTGACAAGATTATCTACAGTAACTTTAATACTCAT
CTTTAACTGACAATCCTATCAAACCCTGATCTCCTGTCTCATTTTTAAAATTACCAACAA
TTTGTAAGTTAGCGAGGGTATAGCAGCAATATCAAGTACACAAATGAATTGCTAAATAAG
TTAGCCTAGGCGTCAAATGATTTCTGCCAATAAATCCCTCGTTAACAATAAAGTCAAAGC
CAAATTGATTAGTAACATCCAAATTAATTTGGGCACATAGATATTTCTTAAGGGATATTG
AATCCCGAACAATAGCAGATAAGTGAAGACTATCAGCTCCACTCTTAACTTTCAAAGCTT
TTTGAATATTGCCTTTTAGAAATAAATGAAGAAGAAAAGAGCTTAGAGAAAAGGAAGAAG
CTGTCGCTCTAAACTTATTAATGTATCAAACGTCATGATAAAAACATAATTGATACTCTT
AAAAAGAGAAGAGGCAGAAAGAAGTTCATTTTAATAGATTAAGTGGTAAAGAGTAGATTA
GGATCTAGGGATGCGAGGTATCTAGAGGAAGTACAGTAGCACTAGATATTGCCAAAATAA
TTACAAACGACTTCTGGCATATAAAATGAGAAGTAGATCGATGGCATCCTGAAAGATATT
AGCAATAAAATTGAATAGATTGAGAAAATTGAGGTGAATGTTATCAACAAAGAGAAGTTG
CAATAGCTGTCAGAAGGCTCTATATAGAAGGATAAAAAGCGCAGACGCACTACGCATTTC
ACACCTTAGAAAGGCAAGAAGAAGAAATCTTTGGTTTTTAGGAGATTGCCAAGATAGGGC
AATGGAAAGAATAAATCAAGATCAAATCGTAGACCCTCTTAAAAATCAAGGTCTCTATCA
TCCTAAAGGACCACTCCTACTCCAAGCAGCATTAAAAAGGGCAGCACCCTCAAGTAAACG
ACTTTGTAGTTTTAACCAACGAGAATTAGCAGTGCCTCCAAAGATATTAGTAAGCAATAT
AATAGACTCGGGTTTGTATCGAGCAACAGCTAAAGCATTCATAACTCAAAAGCAAATAGT
GGAAAAAGCACAATAAACAAAGGCAAACCTCTTAGATGA


>Contig442.1.g2(protein)
MTSTDRKKGAVDMKQFWDQIDKDYFQEINQEDILHFIDSLNSQIDHHYSDKKEALFSQNS
QSASKGVLVVNKSQTPKPSHVSVFSTGTNQLLKREKISQQNLTNQDLPKDSQIEESNSQS
LIQRPQGKQSAGILPSQKARLDQERLLTSHTFEDGGMFGPDLSRFMYMYRQILDRYDIPN
QLQELDDIQMSETQIKLHELRLIEELKEQVGQLFNYRFFKTSKELPRLKKFKPPTLNITI
DSELDKLEHEYGIAQRESRQGLKRFRNAVLSYQQPESVIILKEKSEIERLYLQKTIIQME
LKQLAESITRISSRKNIKSSDELYRFMQNSPMIWDKRTKQDNYVSERNRKKTGWSQKIRE
SQGARQHDEPVFDQKWAVDETYAYSLKFDPSIGVPDTWIDGRVMNYFNAQRDNIFASSSK
YDIVQLRQGEAHYHTTSENTNEEQKQKQNRMLRNRHNRNLSARKRSKSTPAPPNNPVLGP
QAMLEQQMKYFDEDKSNYGFCHHCKQLKNRFVLAKCNYNSAQMGPTVPASYCVKDVKIYN
IDIGNKASYNYLVKQHTTKGKSGINTPFLFNELQAQGIRKDQRGRSRLNSEVLDDNYICS
RMFCSFCLKTQYEVNFGECYNNKDWICPFCQGVCFCTRCLRQDTMTQLKAYFIALGGDLQ
NLQSSECIFDKIIYSNFNTHLQLTILSNPDLLSHFQNYQQFVSQRGYSSNIKYTNELLNK
LAQASNDFCQQIPRQQQSQSQIDQQHPNQFGHIDISQGILNPEQQQISEDYQLHSQLSKL
FEYCLLEINEEEKSLEKRKKLSLQTYQCIKRHDKNIIDTLKKRRGRKKFILIDQVVKSRL
GSRDARYLEEVQQHQILPKQLQTTSGIQNEKQIDGILKDISNKIEQIEKIEVNVINKEKL
QQLSEGSIQKDKKRRRTTHFTPQKGKKKKSLVFRRLPRQGNGKNKSRSNRRPSQKSRSLS
SQRTTPTPSSIKKGSTLKQTTLQFQPTRISSASKDISKQYNRLGFVSSNSQSIHNSKANS
GKSTINKGKPLR