Identifiers and Description

Gene Model Identifier

Contig4316.0.g105

Standard Name

None

Aliases

Contig4316_0_g105

Description

2OG-Fe(II) oxygenase superfamily

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity (IEA) | GO:0016491
  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (IEA) | GO:0016706
  • nucleic acid binding (IEA) | GO:0003676
  • methyltransferase activity (IEA) | GO:0008168

Biological Process

Domains

  • ( pfam13532 ) 2OG-Fe(II) oxygenase superfamily
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam03171 ) 2OG-Fe(II) oxygenase superfamily
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13640 ) 2OG-Fe(II) oxygenase superfamily
  • ( pfam08242 ) Methyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011439005.001313616964319e-114hypothetical protein
SGDYML014W5.999460549133178e-49TRM9 SGDID:S000004476, Chr XII
I from 243225-244064, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4316.0.g105(coding)
ATGGAGAGCTCTGCTGATCTTAAATAAGTTGAAATTCAATAGAATCAACAAGAAGAAATA
AAAAATGATGCATAAGTATAAAATTCACCGAATGATTAAGAGAGTAAAGTTTAAACGGAT
AAAGTTAATAAAGAAGTGAAGCCATCCAAAAGTTAGATTGCAAAAGATGCTAAGAAAATG
AAGAAGAAAGTTGCCTAAGCAGTCACTGTTATTGTGAAAGCAGAAAATCAATCATTTGAG
TAATTAGTTACAAAAGAGCCAGTTAAGTAAGTATTAGTCTCTCATTTTGGTAATGGAGAC
GAGGAAGATCAAAATGTGATTTATGAGTTTGCATCTAAATTCGGTAGCCTAAAGAAAATC
ACGATATTTCCAGGGACAAGCTATGGTCATTTAGAGTTTGAAAATGATTAAGATGTTGCC
GATATGATGGCTAATATGGATGGGCCAAATATTAAGATTCTGAAGTTTTATGGGAAGGAT
AGACATGTTGCGTTTTTCCCTACTCCTGTTAAATTTCAAGAACTTAAAAATAAAGCTACT
GTTGATTTCCCATAGTCAACCAATGCGTTTTCAGGAATTATTCCAGGACTATACGTGTTT
GATGATTTCATAACTCAAGAGGAGGAAGATCAAATGATCATGTAAATGGATAAGCACTAA
TGGATAAAATTATTGAACAGAAGAGTTTAACATTACGGTTATGAGTTTATTTATGGAACC
AACACTGTGGATAAAAATAGTCAGATTGGACCACTCCCTGATTTCTGCTCTTTCTTAATC
CCTAAATTCGAGAAAATCTTGAAGAATTTTGGATTCAACAATCAAAGCGAGGTTATTGAT
TTGGATAAATAAGAGGAAGAATACAAAGAAGACACTTTCGAGGAGAGATTCGGGATGTTC
GATTAACTCACAATAAATGATTATACACCTGGTTAGGGAATACCCCCACATGTTGATACT
CACTCTCCATTCTAAGAAATATTCGTCTCACTTTCCCTATTGAGTGGAGTGTCAATGAAT
TTTAGAACTCCAGAAGGTCAATAAAAAGATGTGTACCTCATACCCAGAAGTTTAGTCTTG
TTTTCAGGTGAAGCCAGATACAACTATCTCCATTCAATTGCAACCAGAAAATTAGACAGC
GTTGAAGGTTTGCTGAAATTCAGACACAGAAGAGTTTCACTTACTTTCAGGAAAATCAAG
CAGGATGCTTGCACATGTAGATTCCCTAAGCTTTGTGATACATAAAATAAGGAAGCAAAC
GTTGATTCAAATAAATTGGCTGGAGAAGGGGAAGAAGCCAAAATAGACCCAGCTAATCTA
GTTGCACTCTCTGCCACTGACATGGAGAAGAAGCATGTATATGAAGTTTATGATAAAATT
GCACCGCATTTCAGCAATACCAGATATAAACCATGGCCTAAGATTTAGAAGTATATGGAG
TCATTGCCTGTTGGGTCATTGAACATTGATGTGGGATGTGGCAATGGAAAATACCTAGGC
TGTAACAAAGACAACGTATTCAGCATAGGCACTGACAGAAGCATAAACTTGCTGGGTATT
TGCAGAGATAGAGGTGAATTCCAAACATTCTACTGCGATTCCCTGAAACTACCAGTAAGA
GATTAAACATTTAACTCTTGTATCTCAATTGCAGTGATCCATCACTTCTCTACTAAAACT
TTGAGAGTTGCTGCTCTGAATGAAATGCATCGAATATTAAAGATAGGCGGGAAAGTGCTG
GTTTATGTTTGGGCCTTTGAGCAAGAAGTGAAAAAGTTCTCTACTCAAGATGTGTTTGTG
CCATGGCACCTACAAGACACCTATGAGGAGGGAAACAAGCAGCAAGACAGCTAAAATAAT
AGCCAATAAAATATTGTATAAAACAATGCAGACGATCACTTGCACGATGATTAAGTAGAG
GAAAATAAATCACAGTCGAGCAGTTCATTTATTGAAACTGGCTTAAGAAATGATGAGAAA
AAAGCGACTGTCTATCACAGATATTATCACATGTTTAAGGAAGGTGAACTCGAAGAACTT
TTTACAGAGAATTTCCAAGGTAGATTTGAAATCAAAGAAAGGTACTATGATCATGCTAAT
TGGGCTGTTATCTGTGAAAAAGTTAGTAATTGA


>Contig4316.0.g105(protein)
MESSADLKQVEIQQNQQEEIKNDAQVQNSPNDQESKVQTDKVNKEVKPSKSQIAKDAKKM
KKKVAQAVTVIVKAENQSFEQLVTKEPVKQVLVSHFGNGDEEDQNVIYEFASKFGSLKKI
TIFPGTSYGHLEFENDQDVADMMANMDGPNIKILKFYGKDRHVAFFPTPVKFQELKNKAT
VDFPQSTNAFSGIIPGLYVFDDFITQEEEDQMIMQMDKHQWIKLLNRRVQHYGYEFIYGT
NTVDKNSQIGPLPDFCSFLIPKFEKILKNFGFNNQSEVIDLDKQEEEYKEDTFEERFGMF
DQLTINDYTPGQGIPPHVDTHSPFQEIFVSLSLLSGVSMNFRTPEGQQKDVYLIPRSLVL
FSGEARYNYLHSIATRKLDSVEGLLKFRHRRVSLTFRKIKQDACTCRFPKLCDTQNKEAN
VDSNKLAGEGEEAKIDPANLVALSATDMEKKHVYEVYDKIAPHFSNTRYKPWPKIQKYME
SLPVGSLNIDVGCGNGKYLGCNKDNVFSIGTDRSINLLGICRDRGEFQTFYCDSLKLPVR
DQTFNSCISIAVIHHFSTKTLRVAALNEMHRILKIGGKVLVYVWAFEQEVKKFSTQDVFV
PWHLQDTYEEGNKQQDSQNNSQQNIVQNNADDHLHDDQVEENKSQSSSSFIETGLRNDEK
KATVYHRYYHMFKEGELEELFTENFQGRFEIKERYYDHANWAVICEKVSN