Identifiers and Description

Gene Model Identifier

Contig4133.0.g46

Standard Name

None

Aliases

Contig4133_0_g46

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006305009.99679536751975e-103EF hand family protein
SGDYBR109C3.0000115468388957e-66CMD1 SGDID:S000000313, Chr II
from 458362-457919, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4133.0.g46(coding)
ATGGCAGATAATCTAACTGAAGAACAAATCGCTGAATTCAAGGAAGCCTTCTCCCTCTTC
GATAAGGACGGTGATGGAACCATCACCACCAAAGAGCTCGGTACCGTCATGAGATCCCTC
GGTCAAAACCCAACTGAGGCTGAACTCCAAGACATGATCAACGAGGTCGACGCTGACGGT
AACGGAACCATCGATTTCCCAGAGTTCCTCTCCCTCATGGCAAGAAAGATGAAGGACACC
GACACCGAGGAGGAGCTTGTTGAGGCCTTCAAGGTCTTCGACAGAGATGGAAACGGTCTT
ATCTCAGCTGCTGAGCTCAGACACGTCATGACCAACCTCGGAGAGAAGCTTACCGACGAA
GAGGTCGACGAGATGATCAGAGAGGCTGATGTTGACGGAGACGGACACATCAACTACGAA
GAATTCGTTAGAATGATGATGGCCAAGTGA


>Contig4133.0.g46(protein)
MADNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLSLMARKMKDTDTEEELVEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGHINYEEFVRMMMAK